Analisis Struktur dan Fungsional Protein (2)

12  14  Download (0)

Teks penuh

(1)

Analisis Struktur dan Fungsional Protein Antifungal (PAF)

dari

Penicillium chrysogenum

PAPER

Karya tulis yang disusun untuk memenuhi salah satu tugas

Bioinformatika

Oleh: KENNIS ROZANA

NIM: 21116012

PROGRAM STUDI BIOTEKNOLOGI SEKOLAH ILMU DAN TEKNOLOGI HAYATI

(2)

Analisis Struktur dan Fungsional Protein Antifungal (PAF)

dari Penicillium chrysogenum

I. PENDAHULUAN

Penicillium sudah sejak dulu dikenal sebagai penghasil antibiotik yang memiliki

(3)

II. METODE

a. Deteksi Domain dan Motif Protein Antifungal dari Penicillium chrysogenum

Pada analisis deteksi motif protein dilakukan pencarian sekuens protein antifungal dari Penicillium chrysogenum pada NCBI. Sekuens protein antifungal yang didapat lalu disimpan dalam format .fasta untuk digunakan dalam analisis selanjutnya. Pada analisis domain dan motif dilakukan secara terintegrasi dengan memanfaatkan beberapa program seperti CDD NCBI, CDART NCBI, SMART, PFAM, dan Interpro-Scan untuk mendapatkan informasi terkait protein antifungal tersebut secara lengkap dan menyeluruh. Analisis dilakukan dengan memasukkan data sekuens protein antifungal yang diperlukan pada masing- masing halaman website program tersebut.

b. Deteksi motif protein antifungal dari beberapa spesies Penicillium menggunakan HMM (Hidden Markov Model) dan T-coffe

Pada analisis deteksi motif protein antifungal dari beberapa spesies Penicillium dilakukan dengan metode MSA (Multiple Sequence Alignment) `dari beberapa sekuens protein antifungal Penicillium dengan menggunakan program T-Coffe. Setelah diperoleh hasil MSA (Multiple Sequence Alignment) dalam format clustalw_aln_file dilanjutkan dengan pembuatan profil HMM serperti HMM Build dan HMM Search pada website HMM https://npsa-prabi.ibcp.fr/cgibin/npsa_automat.pl?page=/NPSA/npsa_server.html.

III. HASIL

(4)

 Protein antifungal dari Penicillium chrysogenum terdiri dari 92 asam amino.

 Sekuens lengkap dari protein antifungal Penicillium chrysogenum tersebut adalah MQITTVALFLFAAMGGVATPIESVSNDLDARAEAGVLAKYTGKCTKSKNEC KYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD

(5)

 Domain yang terdapat pada protein antifungal (PAF) dari Penicillium chrysogenum ada 1 domain yaitu domain “antifungal_prot superfamily” dengan motif dasar domain tersebut sebagai berikut.

39 KYTGKCTKSKNECKYKNDaGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAV 89

1 KYGGKCTKKDNTCKYKKQ-GKTVIVKCPSSANKRCTKDGNHCEYDSYHGKV 50

(6)

 Berdasarkan hasil analisis menggunakan SMART diketahui bahwa protein antifungal dari Penicillium chrysogenum termasuk protein ekstraseluler yang ditandai dengan adanya sinyal peptida pada sekuens 1 – 18. Sinyal peptida tersebut pada umumnya hanya ditemukan pada protein ekstraseluler karena fungsinya untuk memberi arah pada protein agar dapat menentukan lokasi protein tersebut seharusnya berada. Sinyal peptida bersifat spesifik untuk setiap jenis protein ekstraseluler sehingga mencegah kesalahan dalam translokasi protein (Binder et al., 2010).

 Berdasarkan hasil analisis menggunakan SMART juga diketahui bahwa daerah “low complexity” yang memiliki tingkat kekompleksan rendah terdapat pada daerah ke 69 sampai 81. Protein antifungal dari Penicillium chrysogenum tidak memiliki daerah internal repeat. Hal ini dapat disebabkan oleh domain dari protein antifungal yang tidak banyak dan kurang bervariasi (Sonderegger et al., 2016).

(7)

diketahui dari ukuran huruf yang bervariasi, dimana semakin besar ukuran hurufnya maka semakin conserved, sebaliknya semakin kecil ukuran hurufnya maka menunjukkan semakin tidak conserved.

 Berdasarkan hasil analisis PFAM terdapat 32 sekuens yang memiliki arsitektur sama dengan protein antifungal dari Penicillium chrysogenum, seperti sekuens dari Penicillium expansum, Penicillium italicum, Penicillium brasilianum, dan beberapa sekuens organisme lainnya.

(8)

disulfida internal. Sisi kation yang menghubungkan daerah hidrofobik pada permukaan protein tersebut kemungkinan membentuk fosfolipid. Protein antifungal tersebut membunuh fungi dengan merangsang apoptosis atau pembentukan pori pada membran sel sehingga sel kehilangan permeabilitasnya.

 Berdasarkan hasil analisis PFAM juga dapat diketahui tingkat kekerabatan protein antifungal yang ditandai dengan jarak cabang pada pohon filogenetik tersebut. Dimana semakin jauh jarak cabang suatu sekuens dengan sekuens lain maka menunjukkan semakin jauhnya kekerabatannya, sebaliknya semakin dekat cabang suatu sekuens dengan sekuens lain maka semakin dekat kekerabatannya.

(9)

 Berdasarkan hasil analisis PFAM juga dapat diketahui profil informasi HMM seperti Gathering cut-off pada sekuens 25.0 dan pada domain 25.0, Trusted cut-off pada sekuens 29.1 dan pada domain 28.7, Noise cut-off pada sekuens 22.5 dan pada domain 21.5 dengan panjang model 50.

(10)

 Berdasarkan hasil analisis T-Coffe diketahui daerah yang conserved dari beberapa sekuens protein antifungal yang berasal dari beberapa spesies Penicillium. Pada analisis daerah conserved menggunakan T-Coffe mudah dipahami karena menggunakan warna yang berbeda untuk menentukan tingkat conserved dari suatu sekuens. Warna biru menunjukkan kualitas conserved yang sangat buruk, warna hijau menunjukkan daerah conserved yang buruk, warna kuning menunjukkan daerah conserved yang rata-rata, warna pink muda menunjukkan daerah conserved yang baik, dan warna pink tua menunjukkan daerah conserved yang sangat baik. Selain itu, daerah conserved dari semua sekuens protein yang dianalisis juga ditandai dengan tanda asterisk (*) di bagian bawah.

(11)

adalah tidak adanya warna yang memudahkan visualisasi. Akan tetapi hasil clustalw tersebut diperlukan untuk analisis HMM Build dan HMM search.

 Berdasarkan hasil analisis Pro-Dom dapat diketahui struktur motif dari protein antifungal dengan bagian-bagian yang diberi warna berbeda. Pada daerah ungu menunjukkan B-sheet, garis merah menunjukkan loops, dan garis kuning menunjukkan jembatan disulfida.

IV. KESIMPULAN

 Protein antifungal (PAF) dari Penicillium chrysogenum merupakan protein ekstraseluler yang terdiri dari 92 asam amino dan memiliki domain superfamili protein antifungal. Berdasarkan analisis domain dan motif dari SMART, domain superfamili protein antifungal tersebut juga dimiliki oleh Opisthokonta.

 Protein antifungal dari beberapa spesies Penicillium memiliki daerah sekuens yang conserved pada beberapa daerah tertentu pada hasil multiple sequence alignment. Adanya daerah sekuens yang conserved tersebut dapat menunjukkan adanya hubungan kekerabatan antara protein antifungal dari satu spesies Penicillium dengan protein antifungal dari spesies Penicillium lainnya.

V. REFERENSI

(12)

Marx, Florentine, Ulrike Binder, Leiter, Pocsi. 2008. The Penicillium chrysogenum antifungal protein PAF, a promising tool for the development of new antifungal therapies and fungal cell biology studies. Cell Mol Life Sci 65 (3):45-54

Figur

Memperbarui...

Referensi

Memperbarui...