Altschul SF, Gish W, Miller W, Mayers EW, Lipman DJ. 1990. Basic local aligment search tool. J Mol Biol 215:403-410.
Abdullah MAN. 2008. Karakterisasi genetik sapi Aceh menggunakan analisis keragaman fenotipik, daerah D-Loop DNA mitokondria dan DNA mikrosatelit [disertasi]. Bogor : Program Pascasarjana, Institut Pertanian Bogor.
Andreas E. 2010. Telaah kualitas daging serta identifikasi keragaman gen GH dan GHR pada kerbau [tesis]. Bogor : Program Pascasarjana, Institut Pertanian Bogor.
Aggrey SE et al. 1999. Markers within the regulatory region of the growth hormone receptor gene and their association with milk-related traits in Holstein. J Hered 90:148– 151.
Beauchemin VR, Thomas MG, Franke DE, Silver GA. 2006. Evaluation of DNA polymorphisms involving growth hormone relative to growth and carcass characteristics in Brahman steers. Genet Mol Res 5 (3): 438-447.
Bastos E, Cradavor A, Azevedo J, Pinto HG. 2001. Single strand conformation polymorphism (SSCP) detection in six genes in Portuguese indigenous sheep breed “Churra da Terra Quente”. Biotechnol Agron Soc Environ 5 (1): 7-15.
Bugiwati SRA. 2007. Pertumbuhan dimensi tubuh pedet jantan sapi Bali di Kabupaten Bone dan Barru Sulawesi Selatan. J Sains & Teknol 7 (2): 103– 108.
Burnside J, Liou SS, Zhong C, Cogburn LA. 1992. Abnormal growth hormone receptor gene expression in the sex-linked dwarf chicken. Gene Comp
Endocrinol 88:20-8.
Burton JL, McBride BW, Block E, Glimm DR. (1994). A review of bovine growth hormone. CanJ AnimSci 74: 167-201.
Botstein DR, White L, Skolnik M, Davis RW. 1980. Construction of a genetic linkage map in man using restriction fragment length polymorphisms. Am
J HumGenet 32:314.
Direktorat Jenderal Peternakan 2009. Buku Statistik Peternakan Tahun 2008. Departemen Pertanian. Jakarta.
Di Stasio L, Destefanis G, Brugiapaglia A, Albera A, Rolando A. 2005. Polymorphism of the GHR gene in cattle and relationships with meat production and quality. Anim Genet 36:138–140.
Djojosoebagio S. 1996. Fisiologi Kelenjar Endokrin. Penerbit Universitas Indonesia. Jakarta.
39
Curi RA, De Oliveira HN, Silveira AC, Lopes CR. 2005. Effects of polymorphic microsatellites in the regulatory region of IGF1 and GHR on growth and carcass traits in beef cattle. Anim Genet 36:58–62.
Curi RA et al. 2006. Growth and carcass traits associated with GH|AluI and POU1F1|HinfI gene polymorphism in Zebu and crossbred beef cattle.
Genet Mol Bio 29 (1): 56-61.
Edens A, Talamantes F. 1998. Alternative processing of growth hormone receptor transcripts. Endocrinol Rev 19:559–582.
Falconer DS, Mackay TFC. 1996. Introduction to Quantitative Genetics. 4th Ed. Longman Inc. New York.
Ge W, Davis ME, Hines HC, Irvin KM. 2000. Rapid communication: Single nucleotide polymorphisms detected in exon 10 of the bovine growth hormone receptor gene. J Anim Sci 78:2229–2230.
Ge W, Davis ME, Hines HC, Irvin KM, Simmen RCM. 2003. Association of single nucleotide polymorphisms in the growth hormone and growth hormone receptor genes with blood serum insulin-like growth factor I concentration and growth traits in Angus cattle. J Anim Sci 81:641-648. Godowski PJ et al.. 1989. Characterization of the human growth hormone
receptor gene and demonstration of a partial gene deletion in two patients with Laron-type dwarfism. Proc Natl Acad Sci USA 86: 8083– 8087.
Hilderbrand CE, David C, Torney, Wagner RP. 1992. Informativeness of
Polymorphic DNA Markers. Los Alamos Sciences. Brazil.
Hale CS et al. 2000. Decreased growth in Angus steers with a short TG- microsatellite allele in the P1 promoter of growth hormone receptor gene.
J Anim Sci 78:2099– 2104.
Han S H, et al. 2009. A GHR polymorphism and its associations with carcass traits in Hanwoo cattle. Gene Genom 31(1):35-41.
Handiwirawan E, Noor RR, Muladno, Schüler L. 2003. The use of HEL9 and INRA035 microsatellites as specific markers for Bali cattle. Arch Tierz
46(6):503-512.
Handiwirawan E, Subandriyo. 2004. Potensi dan keragaman sumberdaya genetik sapi Bali. Wartazoa 14:3
Hardjosubroto W, Astuti JM. 1993. Buku Pintar Peternakan . PT Gramedia Widiasarana Indonesia. Jakarta.
Hartl DL, Clark AG. 1997. Principle of Population Genetic. Sinauer Associates, Sunderland, MA.
Hayashi K. 1991. PCR-SSCP: A Simple and Sensitive Method for Detection of Mutations in the Genomic DNA. PCR Methods Appl 1: 34-38.
Jakaria. 2008. Keragaman genetik gen hormon pertumbuhan pada sapi Pesisir Sumatera Barat [disertasi]. Bogor : Program Pascasarjana, Institut Pertanian Bogor.
40
Jiang H, Lucy MC. 2001. Variants of the 5’-untranslated region of the bovine growth hormone receptor mRNA: isolation, expression and effects on translational efficiency. Gene 265:45–53.
Kusdiantoro M et al. 2009. On the origin of Indonesian cattle. Plos one 4(5) e5490.
Kwok PY. 2003. Single Nucleotide Polymorphisms Methods and Protocols. Humana Press Inc. New Jersey.
Lawrence TLJ Fowler VR. 2002. Growth of Farm Animals. 2nd Ed. CABI Publishing.
Li WH, Gaur D. 1991. Fundamentals of Molecular Evolution. S,A. Sunderland, Massachusetts.
Listrat A, Gerrard DE, Boulle N, Groyer A, Robelin J. 1994. In situ localization of muscle insulin-like growth factor-II mRNA in developing bovine fetuses.
J Endocrinol 140:179-187.
Liu J, Carroll JA, Matteri RL, Lucy MC. 2000. Expression of two variants of growth hormone receptor Massenger ribonucleic acid in porcine liver. J
Anim Sci 78:306-319.
Lucy MC, Johnson GS, Shibuya H, Boyd CK, Herring WO. 1998. Polymorphic (GT)n microsatellite in the bovine somatotropin receptor gene promoter. J Anim Sci 76: 2209– 2210.
Martojo H. 2003. A Simple Selection Program for Smallholder Bali Cattle Farmers. In : Strategies to Improve Bali Cattle in Eastren Indonesia. K. Entwistle and D.R . Lindsay (Eds). ACIAR Proc. No. 110. Canberra. Masudana IW. 1990. Pengembangan sapi Bali di Bali dalam sepuluh tahun
terakhir (1980-1990). Proceeding Seminar Nasional Sapi Bali. Denpasar, 20-22 September 1990. Fakultas Petemakan Universitas Udayana. Denpasar . h. A-1 I-A-30.
McCormick A, Brady H, Theill LE, Karin M. 1990. Regulations of the pituitary- specific homeobox gene GHF1 by cell autonomous and environmental cues. Nat Lond 345:829-32.
Montaldo HH, Herrera CAM. 1998. Use of molecular markers and major genes in the genetic improvement of livestock. J Biotechnol 1(2).
Moody DE, Pomp D, Barendse W, Womack JE. 1995. Assignment of the growth hormone receptor gene to bovine chromosome 20 using linkage analysis and somatic cell mapping. Anim Genet 26:341– 343.
Mullis K. 1986. Specific enzymatic amplification of DNA in-vitro: the polymerase chain reaction. Cold Spring Harb Symp Quant Biol 51:263- 273.
Namikawa T, Otsuka J, Martojo H. 1980. Coat colour variations of Indonesian cattle. The origin and phylogeny of Indonesian native livestock (Part III): Morphological and genetically investigations on the interrelationship
41
between domestic animals and their wild forms in Indonesia. The
Research Group of Overseas Scientific Survey 31-34.
Nicholas FW. 1996. Introduction to Veterinary Genetics. Oxford University Press. Inc. New York.
Nei M. 1987. Molecular Evolutionary Genetics. Columbia University Press, New York.
Newman S, Coffey SG. 1999. Genetic aspects of cattle adaptation in the tropis.In : Fries R and Ruvinsky A, Ed. The Genetic of Cattle. New York, CABI Publishing.
Noor RR, Barker S, Kinghorn BP. 1993. Effects of strains, strain croses and environments on additive genetic and phenotypic variance in Drosophila
melanogaster. J Anim Breed Genet 110:41-56.
Noor RR. 2002. Genetika Ekologi. Laboratorium Pemuliaan dan Genetika Ternak. Fakultas Peternakan. IPB.
Noor RR. 2008. Genetika Ternak. Penebar Swadaya. Jakarta.
Ohkubo T. 2006. Bos indicus type of growth hormone receptor gene is retained in Japanese Black cattle. J Anim Breed Genet 123:410–413.
Oka IGL, Darmadja D. 1996 . History and development of Bali Cattle . Proc.
Seminar on Bali Cattle, a Special Spesies for the Dry Tropics, Held by
Indonesia Australia Eastern University Project (IAEUP), 21 September
1996 . Udayana University Lodge, Bukit Jimbaran, Bali.
Owen JA, Kind KL, Carbone F, Robinson JS and Owens PC. 1994. Circulating insulin-like growth factors-I and –II and substrates in fetal sheep following restriction of placental growth. J Endocrionol 140:5-13.
Pan CY et al. 2008.A DdeI PCR-RFLP detecting a novel missense mutation of
the POU1F1 gene showed no effects on growth traits in cattle. Czech J
Anim Sci 53(12):523–527.
Pane I. 1986. Pemuliabiakan Ternak Sapi. Gramedia. Jakarta.
Pane I. 1991. Produktivitas dan breeding sapi Bali. Pros. Seminar Nasional Sapi Bali. 2-3 September 1991. Fakultas Peternakan Universitas Hasanudin. Ujung Pandang.
Payne WJA , Rollinson DHL. 1973. Bali cattle. World Anim Rev. 7:13-21 .
Payne WJA, Hodges J. 1997. Tropical Cattle: Origin, Breeds and Breeding
Policies. Blackwell Science.
Pereira AP, de Alencar MM, de Oliveira HN, Regitano LCA. 2005. Association of GH and IGF-1 polymorphisms with growth traits in a synthetic beef cattle breed. Genet Mol Biol 28(2):230-236.
Ponzoni RW. 1997. Genetic resources, conservation. In : Paper L and Ruvinsky A, Ed. The Genetic of Sheep. New York, CABI Publishing.
42
Reardon W, Mullen AM, Sweeney T, Hamill R M. 2010. Association of polymorphisms in candidate genes with colour, water-holding capacity, and composition traits in bovine M. longissimus and M.
semimembranosus. Meat Sci (In Press).
Rollinson DHL. 1984. Bali Cattle. In : Evolution of Domesticated Animals. Mason, IL. (Ed.). NewYork. Longman.
Sastradipradja D. 1990. Potensi internal sapi Bali sebagai salah satu sumber plasma nutfah untuk menunjang pembangunan peternakan sapi potong dan ternak kerja secara nasional . Pros. Seminar Nasional Sapi Bali. Denpasar, 20-22 September. Denpasar: Fakultas Peternakan Universitas Udayana. hlm. A-47-A-54.
Saladin R. 1983. Penampilan sifat-sifat produksi dan reproduksi sapi lokal Pesisir Selatan di Propinsi Sumatera Barat. (Disertasi). Sekolah Pascasrjana IPB. Bogor.
Scanes SG. 2003. Biology Growth of Domestic Animals. Iowa State Press. Iowa. Sumantran V N, Tsai ML, Schwartz J. 1992. Growth hormone induces c-fos and
c-jun expression in cells with varying requirements for differentiation.
Endocrinol 130: 2016–2024.
Sumantri C, Anggraeni A, Farajallah A, Perwitasari D. 2007. Keragaman mikrosatelit DNA sapi perah FH di balai pembibitan ternak unggul Baturraden. J Ilmu Ternak Vet 12(2):124-133.
Talib C. 2002. Sapi Bali di daerah sumber bibit dan peluang pengembangannya.
Wartazoa 12:3.
Tatsuda et al. 2008. Relationship of the bovine growth hormone gene to carcass traits in Japanese black cattle. J Anim Breed Genet 125(1):45-49.
Tuggle CK, Trenkle A. 1996. Control of growth hormone synthesis. Domest Anim
Endocrinol 13:1–33.
Vanderpooten A, Huybrechts LM, Decuypere E, Kuhn ER. 1991. Differences in hepatic growth hormone receptor binding during development of normal and dwarf chickens. Repro Nuti Dev 31:47-55.
Weir BS. 1996. Genetic Data Analysis : Method for Discrete Population Genetic
Data. Second ed. Sinauer Associates. Sunderland, MA USA.
Womack JE. 1993. The goals and status of the bovine gene map. J Dairy Sci
76:1199–1203.
Woychick RP et al. 1982. Cloning and nucleotide sequencing of the bovine growth hormone gene. Nucleic Acids Res 10:7197–7210.
Wu M et al. 2008. Increased degradation of insulin-like growth factor-I in serum from feed-deprived steers. Domest Anim Endocrinol 35:343–351.
Zhou Y, Jiang H. 2005. Trait-associated sequence variation in the bovine growth hormone receptor 1A promoter does not affect promoter activity in vitro.
44
Lampiran 1. Sekuens gen reseptor hormon pertumbuhan (GHR) pada sapi yang diakses di Gen Bank (Kode Akses. EF207442).
LOCUS EF207442 3876 bp DNA linear MAM 10-MAY-2007 DEFINITION Bos indicus growth hormone receptor (GHR) gene, complete cds. ACCESSION EF207442
VERSION EF207442.2 GI:146386137 KEYWORDS .
SOURCE Bos indicus (Bos taurus indicus) ORGANISM Bos indicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos.
REFERENCE 1 (bases 1 to 3876)
AUTHORS Tantia,M.S., Bharani Kumar,S.T., Mishra,B. and Vijh,R.K. TITLE Bos indicus GHR gene for growth hormone receptor, exons 1-10 JOURNAL Unpublished
REFERENCE 2 (bases 1 to 3876)
AUTHORS Tantia,M.S., Bharani Kumar,S.T., Mishra,B. and Vijh,R.K. TITLE Direct Submission
JOURNAL Submitted (04-JAN-2007) Animal Genetics, National Bureau of Animal Genetic Resources, Post Box 129, Karnal, Haryana 132001, India REFERENCE 3 (bases 1 to 3876)
AUTHORS Tantia,M.S., Bharani Kumar,S.T., Mishra,B. and Vijh,R.K. TITLE Direct Submission
JOURNAL Submitted (10-MAY-2007) Animal Genetics, National Bureau of Animal Genetic Resources, Post Box 129, Karnal, Haryana 132001, India REMARK Sequence update by submitter
COMMENT On May 10, 2007 this sequence version replaced gi:124244281. FEATURES Location/Qualifiers source 1..3876 /organism="Bos indicus" /mol_type="genomic DNA" /db_xref="taxon:9915" gene 10..>3876 /gene="GHR" mRNA join(10..35,200..280,416..481,675..804,935..1095, 1321..1499,1612..1777,1981..2071,2246..2315, 2609..>3876) /gene="GHR"
/product="growth hormone receptor" exon 10..35 /gene="GHR" /number=1 gap 89..188 /estimated_length=unknown exon 200..280 /gene="GHR" /number=2 CDS join(211..280,416..481,675..804,935..1095,1321..1499, 1612..1777,1981..2071,2246..2315,2609..3580) /gene="GHR" /codon_start=1
/product="growth hormone receptor" /protein_id="ABM92307.2" /db_xref="GI:146386138" /translation="MDLWQLLLTLAVAGSSDAFSGSEATPAFLVRASQSLQILYPVLE TNSSGNPKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVS AGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISL TEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLMVTSVPMYSLRL DKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQFPWFLIIIFGILGLAV TLFLLIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKHEFYN DDSWVEFIELDIDDPDEKTEGSDTDRLLSNDHEKSLNIFGAKDDDSGRTSCYEPDILE ADFHVSDMCDGTSEVAQPQRLKGEADISCLDQKNQNNSPSNDAAPASQQPSVILVEEN KPRPLLIGGTESTHQAVHTQLSNPSSLANIDFYAQVSDITPAGNVVLSPGQKNKTGNP QCDTHPEVVTPCQANFIVDNAYFCEVDAKKYIALAPHVEAESHVEPSFNQEDIYITTE SLTTTAGRSGTAEHVPSSEIPVPDYTSIHIVQSPQGLVLNATALPLPDKEFLSSCGYV STDQLNKIMP" gap 305..404 /estimated_length=unknown exon 416..481 /gene="GHR"
45 /number=3 gap 520..619 /estimated_length=unknown variation 658 /gene="GHR" /note="SNP" /frequency="0.41" /replace="c" exon 675..804 /gene="GHR" /number=4 variation 801 /gene="GHR" /note="SNP" /frequency="0.12" /replace="a" gap 820..919 /estimated_length=unknown exon 935..1095 /gene="GHR" /number=5 gap 1155..1254 /estimated_length=unknown exon 1321..1499 /gene="GHR" /number=6 variation 1376 /gene="GHR" /note="SNP" /frequency="0.07" /replace="a" variation 1478 /gene="GHR" /note="SNP" /frequency="0.12" /replace="g" gap 1501..1600 /estimated_length=unknown exon 1612..1777 /gene="GHR" /number=7 gap 1807..1906 /estimated_length=unknown variation 1942 /gene="GHR" /note="SNP" /frequency="0.24" /replace="a" variation 1966 /gene="GHR" /note="SNP" /frequency="0.14" /replace="g" variation 1975..1977 /gene="GHR" /note="del" /frequency="0.05" exon 1981..2071 /gene="GHR" /number=8 variation 2001 /gene="GHR" /note="SNP" /frequency="0.20" /replace="c" variation 2081 /gene="GHR" /note="SNP" /frequency="0.21" /replace="t" variation 2109 /gene="GHR" /note="SNP" /frequency="0.13"
46 /replace="a" gap 2136..2235 /estimated_length=unknown exon 2246..2315 /gene="GHR" /number=9 gap 2387..2486 /estimated_length=unknown exon 2609..>3876 /gene="GHR" /number=10 variation 2990 /gene="GHR" /note="SNP" /frequency="0.06" /replace="g" variation 3310 /gene="GHR" /note="SNP" /frequency="0.10" /replace="t" variation 3597 /gene="GHR" /note="SNP" /frequency="0.08" /replace="t" ORIGIN
1 gaaccgcgct ctctctcccg aggctcggct cgcaggtact ggaagggagg tccgggatcg 61 ggctgttact tttccactgt tgtgtcgg [gap 100 bp] Expand Ns
189 ta tgattgcagg tcctacaggt atggatctct ggcagctgct gttgaccttg 241 gcagtggcag gctccagtga tgctttttct gggagtgaag gtgagttctg cttttccatt 301 ccca [gap 100 bp] Expand Ns
405 ttgtct ttcagccaca 421 ccagctttcc ttgtcagagc atctcagagt ctgcagatac tatatccagt cctagagaca 481 agtaagaatt tcagtccttt ttctgccttt ggcgataat [gap 100 bp] Expand Ns
620 g gaccatccat taccctcctg atttcatgac ttgtcttgtc 661 tttttactct gcagattctt ctgggaatcc taaattcacc aagtgccgtt cacctgaact 721 ggagactttc tcatgtcact ggacagatgg ggctaatcac agtttacaga gcccaggatc 781 tgtacagatg ttctatatca gaaggtatgg gcttcatgc [gap 100 bp] Expand Ns
920 t accctccatt tcagggacat tcaagaatgg aaagaatgcc 961 ccgattacgt ctctgctggt gaaaacagct gttactttaa ttcgtcttat acctctgtgt 1021 ggacccccta ctgcatcaag ctaactagca atggcggtat tgtggatcat aagtgtttct 1081 ctgttgagga cataggtaaa tcacaggttt gtgttttatt tgacatggct ttagattaca 1141 taagcgggga aggc [gap 100 bp] Expand Ns
1255 tcggaa 1261 aaatgcattc cactaacatc aagctatgtc tgtgtactaa ttctctgctg aaatgcacag 1321 tacaaccaga tccacccgtt ggcctcaact ggactctact gaacatcagt ttgacggaga 1381 ttcatgccga catcctagtg aaatgggaac caccacccaa tacagatgtt aagatgggat 1441 ggataatcct ggagtatgaa ctgcactata aagaactaaa tgagacccag tggaaaatgg [gap 100 bp] Expand Ns
1601 tgtcttgaaa gatggaccct 1621 ttaatggtaa catcagttcc gatgtactcg ttgagactgg ataaagagta tgaagtgcgt 1681 gtgagaacca gacaacgaaa cactgaaaaa tatggcaagt tcagtgaggt gctcctgata 1741 acatttcctc agatgaaccc atctgcatgt gaagaaggta aacctaagag attaaggtgg 1801 cagcca [gap 100 bp] Expand Ns
47
1921 aatgagatat aaacttcaac tgttcatagt tctgtgagat attatttttg tgtttttcag 1981 atttccagtt tccatggttc ttaattatta tctttggaat acttgggcta gcagtgacat 2041 tatttttact catattttct aaacagcaaa ggtaagtgtg atataaccta ctctgatatg 2101 ttttgccagt tatttagcaa atgtccatgt ttcca [gap 100 bp] Expand Ns
2236 tgttt tcaaggatta agatgctgat tctaccccca gttccagttc 2281 caaagattaa aggaattgat ccagatctcc tcaaggtaat taataaaata tctaagttgt 2341 acatgacact aattaaatgt taccttaaga acagagcctt atgttg [gap 100 bp] Expand Ns
2487 cttc actaatgtat ttgttacatg gtttgttata 2521 tgattttgtt actgattaga ctcaatatta tttgttaaat caattgttgt gaatttattt 2581 tcatagatct tctttttcta ttttatagga aggaaaatta gaagaggtga atacaatctt 2641 agccattcat gacaactata aacacgaatt ctacaatgat gactcttggg ttgaatttat 2701 tgaactagat attgatgacc ctgatgaaaa gactgaaggg tcagacacag acagacttct 2761 gagcaatgat catgaaaaat cactcaatat ctttggggca aaggatgatg actctgggcg 2821 taccagctgc tatgaacctg acattctgga ggctgatttc catgtcagtg acatgtgcga 2881 tggtacctca gaggttgctc agccacaaag gttaaaaggg gaagcagata tctcatgcct 2941 tgatcagaag aatcaaaata attcaccttc taatgatgct gcccctgcta gccagcagcc 3001 cagtgttatc ctagtagagg aaaacaaacc aagaccactt ctcattggtg gaactgagtc 3061 aactcatcaa gctgtccata cacagctcag caatccaagt tcattggcaa acattgattt 3121 ttatgcccag gtaagcgaca ttacaccagc aggaaatgtg gtcctttccc caggccaaaa 3181 gaataagact gggaaccccc agtgtgacac gcacccagaa gtggtcacac cctgccaagc 3241 taacttcatc gtggacaacg cttacttctg cgaggtagac gccaaaaagt acattgccct 3301 ggcccctcac gtcgaggctg aatcacacgt agagccaagc tttaaccagg aagacattta 3361 catcaccaca gaaagcctta ccactacagc tgggaggtcg gggacagcag aacatgttcc 3421 aagttctgag atacctgtcc cagattatac ctccattcat atagtacagt ctccacaggg 3481 cctcgtactc aatgcgactg ccctgccctt gcctgacaaa gagtttctct catcatgtgg 3541 ctatgtgagc acagaccaac tgaacaaaat catgccatag cttttctttg atttcccatg 3601 agctacccat tgaatggcac agggttggct ggggcatgaa tgcttaaacc aaaacaatgt 3661 ttaaactttt tttgggaggg gggtgagttg agggtgggga atatgaattc taaatgcctt 3721 ttcctgaaat gttgaaacat tatattaaaa aaagaagaag aatccttaat cagataaata 3781 ttgctgttgt gaattgtaaa tactttaaag aactgtctca aagactgttt agtggcagta 3841 attgtcttgt tattgtgggt gttaattttg tgctac
48
Lampiran 2. Modifikasi Metode Isolasi DNA Menggunakan Genomic DNA Mini Kit Geneaid
200 µl sampel darah dalam EtOH + DW sampai 1 ml Vorteks Sentrifugasi 8000 rpm, 5 menit Supernatan dibuang + DW sampai 1 ml Vorteks, diamkan ± 20 menit Sentrifugasi 8000 rpm, 5 menit Supernatan dibuang + 1 x STE sampai 360 μl + 5 mg/ml proteinase K 10 μl + Bufer GB 250 μl Inkubasi 56°C, 1 jam + 10 % SDS 40 μl Inkubasi 70°C, 10 menit
+ 200 μl EtOH, Pindahkan ke GD Column
Sentrifugasi 13000 rpm, 2 menit Buang sisa + 400 μl W1 bufer Sentrifugasi 13000 rpm, 30 detik Buang sisa + 600 μl wash bufer
Sentrifugasi 13000 rpm, 3 menit, Pindahkan ke tabung 1,5 ml + 100 μl elution bufer
Sentrifugasi 13000 rpm, 30 detik