Pengaruh Kualitas Pelayanan Publik Terhadap Loyalitas Pelanggan (Studi Pada PT. Kereta Api Indonesia (Persero) Divisi Regional I Sumatera Utara)

Teks penuh

(1)

DAFTAR PUSTAKA

Aulia Paramitha Rany. 2010. “Analisis Faktor Kepercayaan Dan Implikasinya Terhadap Loyalitas Pelanggan pada Telkom Speedy. Tesis. Fakultas Ekonomi Universitas

Diponegoro. Semarang

Griffin, Jill, 2010. Customer Loyalty : Menumbuhkan dan Mempertahankan Griffin, Oliver, 2010. Loyalitas Konsumen. Erlangga Gramedia, Jakarta.

Hurriyati, Ratih. 2010. Bauran Pemasaran dan Loyalitas

Kotler dan Keller.2012. Marketing Management Edisi 14, Global Edition. Pearson Prentice.

Michell, Suhardi. 2006. Akuntansi Untuk Bisnis Jasa dan Dagang. Graha Ilmu, Yogyakarta.

Rahmayanty, Nina. 2010. Manajemen Pelayanan Prima. Yogyakarta: Graha Ilmu

Ratminto dan Atik Septi Winarsih. 2005. Manajemen Pelayanan. Yogyakarta: Pustaka

Belajar.

Saleh, A. Mufawik. 2010. Public Service. : Communication. Malang. UMM Press.

Sinambela, Poltak.Lijan. Reformasi Pelayanan Publik Teori, Kebijakan, dan

Implementasi. Jakarta: PT. Bumi Aksara, 2010.

(2)

Sugiyono. 2009. Metode Penelitian Kuantitatif Kualitatif dan R&D. Bandung : Alfabeta.

Sugiyono. 2012. Metode Penelitian Kuantitatif Kualitatif dan R&D. Bandung : Alfabeta.

Tangkilisan, Nogi S., Hesel, 2005, Strategi Keunggulan Pelayanan Publik: Manajemen

Sumber Daya Manusia Birokrasi Publik (Konsep - Teori & Praktek Manajemen

Sumber Daya Manusia Berdasarkan Konsep Russel), Kerjasama Yayasan

Pembaharuan Administrasi Publik Indonesia & Lukman Offset, Yogyakarta.

Tjiptono, Fandy. 2005. Pemasaran Jasa. Malang: Bayumedia.

Tjiptono, Fandy. 2012. Service Management Mewujudkan Layanan Prima.Fokus Media. Bandung.

Usman, Husaini dan Akbar, Purnomo Settiady. 2006. Metodologi Penelitian Sosial.Jakarta : Bumi Aksara

Yamit, Zulian. 2010. Manajemen Kualitas Produk dan Jasa.Ekonesia.Yogyakarta.

Jurnal

Andrew Santoso, Achmad Fauzi, dan Sunarti. 2015.Pengaruh Kualitas Pelayanan Terhadap Kepuasan Pelanggan (Survei Pada Penumpang Kereta Api Argo Bromo

Anggrek Jurusan Surabaya – Jakarta)

MadeIrvan Hilmawan dan Alit Suryani. 2012. Pengaruh Kualitas Layanan Terhadap

(3)

Mochamad Rizki Yulian. 2013. Pengaruh Kualitas Pelayanan PT. Kereta Api Indonesia (PT.KAI) PERSERO Terhadap Kepuasan Konsumen (Studi Kasus KA Eksekutif Argo

Parahyangan)

Tia Indriani. 2015. Pengaruh Kualitas Pelayanan dan Harga Tiket Terhadao Loyalitas Pelanggan Jasa Kereta Api (Survei Pada Penumpang Kereta Api Ciremai Ekspress Rute

(4)

BAB III

DESKRIPSI LOKASI PENELITIAN

A. Sejarah PT. Kereta ApiIndonesia (Persero) Divisi Regional I

SumateraUtara

PT.Kereta ApiIndonesia(Persero)adalahsebuahBadanUsahaMilik Negara(BUMN)yangbergerak dibidang jasatrasnportasipengangkutan penumpang dan barang, negosiasi dan peti kemas menggunakan kereta api sebagai sarana.

Kereta api itu sendiri untuk pertama kali diperkenalkan di Indonesia padazamanpenjajahan Belandapadatahun1864denganmembangun

lintasandiSemarang(Kamijen).SaatiniPT.KeretaApiIndonesia(Persero) sudah mulaiberkembang dengan kantorpusatdi Bandung. Pertamakalilokomotif ditemukan oleh George Stephenson (Inggris) tahun 1814, pada waktu itu

masyarakatmenamakannyadengan sebutan“KudaBesi”.Penemuantersebut membawa angin baru yang mekanis dan membawa sejarah bangsa-bangsa di dunia, terlebih pertumbuhan ekonomi khususnya.

Awalperjalananitulah tepatnyapadatanggal 17Juni1864,Gubernur JendralSloedvanBeelemelakukanperjangkauanpertamatanda dimulainya

perkeretaapiandiIndonesia,denganmemasanglintasdi Semarang(Kamijen). Sesuaidenganposisi Indonesiasaat itumerupakandaerah jajahan,motif-motif pendirian keretaapi beranjak dari kepentingan negara penjajah, yaitu:

1. Motif Ekonomi/Komersil, yaitu pengiriman hasil bumi Indonesia ke pelabuhan Semarang.

(5)

MotifPolitik/Pertahanan,yaitumerupakanalasandanpondasiyangs angat kuat.Semenjak pembuatan lintasan kereta api tersebut, pertumbuhan selanjutnya di wilayah Indonesia, khususnya di pulau

Jawa semakin diperhatikan dan diperluasdenganmotifyangsama.Pertumbuhankeretaapi

tersebutbukansaja dipeloporiolehpemerintahanBelandatetapi jugaolehperusahaan-perusahaan Belanda,misalnyadipulauJawa seperti:SCS(SemarangCirebonStoom)

Maatschappi),SLS(SemarangJoanaStoom

TrainMaatschappi),KSM(Kediri StoomTrainMy), MSM(Malang

StoomTrain My), dan lain-lain.

WilayahSumaterakhususnyabagianutaram perusahaanswastaBelanda DSM (Deli Spoorweir Maatschappi) membuka jaringan pertama di Sumatera Utara

lintas labuhan Medansekitartanggal17 Juli1886 denganmotif yangsama yaitu mengangkathasil perkebunandaripedalamankepelabuhan timuryaitu pelabuhan Belawan. PadaPerangDuniaIIpadamasapendudukanJepang(1Maret1941–17

Agustus 1945)semua kereta apidiIndonesia dibawah pendudukan Jepang, diubah namanya.SepertidiJawadinamakanRikutu Kyokukemudianberubahdengan

Tetsudo Kyokayang berpusatdiBandung. Di Sumatera, operkertaapian dibawah pemerintahanAngkatanLautJepang dengannamaTetsudoTaiyangberpusatdi BukitTinggi.StatusperkertaapiandiSumateramengalamiprosesyangagak

berbedadengankereta apilainnya.Sesudahberakhrnya pendudukanJepang, Kereta Api diSumatera Utara menjadi perusahaanswasta Belandadi wilayah Republik

(6)

Sementara itu berdasarkan surat perintah penguasaan militer tanggal6 Desember1958NVDSM,beradadibawahpwngawasanmiliterdariKomandoT

danTI.KemudianberdasarkanSKPanglimaTdanTIpenguasaanmilitertanggal

10Desember1957NomorPan/KPTS-045/12/57 Juncto,radiogram Kasad/Penguasa Militer Pusat tanggal 18 Desember 1957 Nomor 11.602/57 tentang

pengambilanalihwewenangBahardariperusahaanmilikBelandaoleh penguasa militer daerahSumatera Utara.

Tanggal 14 Desember 1957 wewenang Bahar atas NV DSM kepada

PanglimaTdanTI,mulai29April1963berdasarkanUndang-UndangTahun 1958JunctoPP.41Tahun1959denganSKMenhubtanggal17Januari1963

Nomor37/120PT.KeretaApi (Persero)IndonesiaLADSMyangberpusatdi Bandung, kemudian berdasarkan Undang-Undang Nomor86 Tahun 1958 DKA berubah menjadi PN PERJAN.

Tahap-tahapperkembangan perkereta apian secara umum:

a. Jaman Republik Indonesia (17 Agustus 1945 – 18 Desember1948) September 1945 secara resmi lahirlah DKARI (Djawatan Kereta

Api RepublikIndonesia)yangberpusat diBandung.Sementarapadawaktuitu hanya meliputi Jawa, karena

perkertaapian di Sumatera Utara berdiri sendiri. b. PengesahanKedaulatan

Januari1950terjadipenggabunganantaraDKARIdenganSS/VS

(Staats Spoorweg/Verenigf SpoorwegBedryf)yangdikuasai Belandamenjadi DKARIS (Djawatan Kereta ApiRepublik

(7)

DKARIS berubah menjadi DKA.

c. PerusahaanNegara

Mei1963DKAberubahmenjadiPNKA(PerusahaanNegaraKeretaApi) berdasarkanUndang-Undang Nomor 22 Tahun 1963.

d. PengesahanJawatan

DenganPP Nomor61/71,15September1971telahditetapkanperubahan

status PNKAmenjadi Perusahaan Jawatan (Perjan).

e. PerusahaanUmum

DenganPPNomor57Tahun1993,tanggal 10Oktober 1990ditetapkan

perubahan atasstatusPerusahaan

JawatanmenjadiPerusahaanUmumKereta Api (PERUMKA), berlaku mulai tanggal 10 Oktober 1990.

f. Persero

DenganPPNomor19Tahun1998ditetapkan bentukdari PERUMmenjadi Persero.Dalam

rangkasebagianpelimpahanwewenangpemerintahdengan

PeraturanPemerintahNomor57Tahun1990,PerusahaanJawatanKereta Api (PJKA) diubah bentuknya menjadi Perusahaan Umum

Kereta Api (PERUMKA), kantor pusat PERUMKA berkedudukan diBandung.

g. Susunan Organisasi PT. Kereta ApiIndonesia(Persero)

1) Kereta ApiPusat di Bandung

(8)

3) Divisi Usaha Pendukung di Bandung

4) Divisi Pelatihan di Bandung

5) Divisi Angkutan Perkotaan di Bandung

6) Divisi Regional I Sumatera Utara diMedan

7) Divisi Regional II di Padang

8) Divisi Regional III Sumatera Selatandi Palembang

9) Daerah Operasional:

a) Daerah Operasi 1 di Jakarta

b) Daerah Operasi 2 di Bandung

c) Daerah Operasi 3 di Cirebon

d) Daerah Operasi 4 di Semarang

e) Daerah Operasi 5 di Purwekerto

f) Daerah Operasi 6 di Yogyakarta

g) Daerah Operasi 7 di Madiun

h) Daerah Operasi 8 di Surabaya

i) Daerah Operasi 9 di Jember

Proses perubahan PERUMKA sehingga menjadi PT. Kereta Api Indonesia (Persero)melaluikeputusanPresidenatau KepresNomor39/1999, 1Juni PERUMKAsecara resmiberubahmenjadiPT.KAI(Persero)mengoperasikan

kelasBisnis,Eksekutif, EkonomidankelaskhusussecarakomersilpadaKereta Api penumpang serta angkutan barang, negosiasi dan peti kemas. Perumka berhasil

meningkatkan perusahaan lain guna lebih mengefisiensikan aset-aset yang dimiliki seperti gudang, tanah dan lainnya.

(9)

Struktur organisasidiperlukanuntukmembedakanbatas-bataswewenang dantanggungjawabsecara sistematisyangmenunjukkanadanya hubungan/ keterkaitan antarsetiap bagianuntukmencapai tujuanyang telahditetapkan.PT.

Kereta Api Indonesia (Persero) Divisi Regional I Sumatera Utara memiliki strukturorganisasigaris danstaf (lineandstaff organization)yangsesuaidengan

(10)

C. Uraian Tugas

Uraiantugasadalahsuatugambarantentangfungsi-fungsitertentuyang

(11)

mempunyaifungsi-fungsiyang harusdipisahkan agartidak terjadikecurangan dalam

operasionalperusahaan.Berikutiniadalahgambarantentangfungsi-fungsi dan pembagian tugas dan tanggung jawab yang ada pada PT. Kereta Api

Indonesia(Persero).

1. Kepala Divisi (KADIV)

KepalaDivisiadalah sebagianunsurpimpinan danpelimpahanwewenang daripimpinanpusatyangbertugas untukmengkoordinasiseluruhunitkerjadari

bagianoperasionaldan berfungsimengawasisertamemberikanarahanbagipara stafnya yaitu Kasi (Kepala Seksi) danmenyampaikan tujuanperusahaan. Adapun seksi tersebut adalah:

a. Seksi Administrasi

Kepala Seksi Staf Kepala Divisi yang dibantu oleh para Subsi dalam bidang administrasiantara lain personalia, keuangan, akuntansi, dan anggaran,kerumahtanggandanhukum sertaKasBesaryangmempunyai

fungsimasing-masinguntukmemperlancar jalannya rodaperputaran perusahaan dibidang administrasi yang diatur oleh ketetapan-ketetapan serta

keputusan-keputusan perusahaan.

b. Seksi Hiperkes dan Keselamatan Kerja

Bertugas sebagaipengawas dibidang kesehatan dan keselamatan kerja sertapelayananyangdikepalaioleh seorangKasiHiperkes yangdibantu oleh Sub Seksi, antaralain:

1) Sub Seksi Hiperkes

2)Sub Seksi KeselamatanKerja

(12)

Berfungsidalam

pengendalianmutu,pemeliharaansertapemeriksaanjalan atau jembatanyangakan dilintasikeretaapiyang dipimpinolehKasiJalan

dan Jembatan dan dibantu oleh beberapa Sub Seksi, antaralain: 1) Sub Seksi Program

2) Sub Seksi Jalan Rel 3) Sub Seksi Jembatan c. Seksi Sarana

Berfungsidibidangpemeliharaan sertamenyediakanperalatandanarmada

bagisetiapsaranayangdiperlukandalam

kegiatanoperasidandigunakan demikelancaranperjalanankereta

apiyangdikepalaioleh seorangKasi Sarana dandibantu olehbeberapa unit, antaralain:

1) Unit Rencana 2) Unit Produksi 3) Unit QualityControl

4) Unit Pendayagunaan Sarana d. Seksi Operasi dan Pemasaran

Berfungsi merencanakanperjalanankeretaapi sehingga pelanggan

yang menggunakanjasakeretaapidapat

menikmatiperjalanansampaiditujuan

(13)

1) Sub Seksi ProgramPerjalanan KeretaApi

2) Sub Seksi Pengendali Operasi Kereta Api 3) Sub Seksi Pemasaran dan Bina Pelanggan

4) Sub Seksi Keamanan dan Ketertiban e. Seksi Sinyaldan Telekomunikasi

Berfungsi dibidang pengendalian mutu serta prasarana sinyal dan telekomunikasi. Seksiinidibantu oleh beberapaSub

Seksi,antaralain:

1) Sub Seksi Program

2) Sub Seksi Sinyal

3) Sub Seksi Telekomunikasi

f. Seksi Tanahdan Bangunan

Berfungsidibidangpengendalianmutusertapengolahandan

pemeliharaan harta tetapmilikPT.

KeretaApiIndonesia(Persero)serta memberdayakan lahanataupuntanahdanbangunan.Seksiinidibantuoleh

beberapaSub Seksi, antaralain:

1) Sub Seksi Program

2) Sub Seksi Tanah 3) Sub Seksi Bangunan

2. Tugas dan Tanggung Jawab

a. Menjalankan kebijakan Direktur Utama Kereta Api (Dirutka)

dalam memimpinPerusahaan Umum

(14)

kepadaperaturan, ketentuan perusahaan, anggaran pendapatan dananggaranbiayasertaketentuanlainnyayangdijalankan secara efektifdan efisiensertatanggung jawab atas manajemen bulanan.

b. Didalam melaksanakantugasnya yang telah ditentukan oleh Dirutkan, pengawasandilaksanakan secara langsung.

c. Menjalankan kerjasama yang baik dengan semua pegawai dalam hubungan tugas yang berhubungan dengan perusahaan umumkereta api.

d.

Menyelenggarakanadministrasiumumkeretaapidalamartikataselu

as- luasnya.

e.

Membuatperencanaanmaterialdanmelaksanakanpengadaan,baik

yang diusahakan sendiridanmengawasipenggunaannya,memeliharaserta menjaga

keamanan.

f.

Menggunakanpegawaisecaraefektifdanefisiensertamengusahaka n penataran serta pendidikan kepegawaian agar

menjaditerampil.

g. Membuat laporan-laporan kegiatan sesuai dengan jadwal yang telah ditetapkan.

(15)

i. Memelihara hubungankerjasama yang baik dengan pegawai instansi pemerintah dan masyarakat guna mencapaitujuan perusahaan.

3. Wewenang a.

Berwenangmengambilkeputusanyangbersifatrutindantidakprinsi pil serta tidak menyimpangdarikebijakanDirekturUtama PT.KeretaApi Indonesia(Persero).

b. Berwenang menandatanganisurat-surat yang sifatnya rutin dan tidak prinsipil.

Adapuntugasdantanggungjawab pimpinansetiapKepalaSubBagian (Kasubag)PT.KeretaApiIndonesia(Persero)

DivisiRegionalISumateraUtara adalah sebgai berikut:

1) Kepala Sub Bagian Seksi Sumber Daya Manusia

KepalaSub BagianSeksiSumberDayaManusiamemilikitugasdan

tanggungjawabpokokyaitumelaksanakankebutuhanadministrasi

dan sistem

informasisumberdayamanusiasertamelaksanakanpengendalian, pembinaan, pelatihan, sertifikasi danevaluasi kinerja.

2) Kepala Sub Bagian Seksi Keuangan

Kepala Sub Bagian seksiKeuangan memilikitugas dan tanggung jawab pokok yaitumelaksanakan pengelolaan administrasi keuangan, pengesahan pembayaranpengeluaran atau biaya

(16)

3) Kepala Sub Bagian Seksi Anggarandan Akuntansi Adapuntugasdantanggungjawabpokokdari

KepalaSubBagianSeksi AnggarandanAkuntansiadalah

menyusunrencanakerjaanggaran tahunan divisi, melaksanakan penyusunan rencana dan pengendalian pelaksanaan

anggaranbelanjadanpendapatansertaprosesakuntansidan

verifikasi semua data administrasi diDivisi Regional I Sumatera Utara.

4) Kepala Sub Bagian Seksi Kerumahtanggaan UmumDan Hukum

Adapuntugasdantanggungjawabpokokdari

KepalaSubBagianSeksi KerumahtanggaanUmumdanHukum adalahmelaksanakankegiatan protokoler, tata usaha,

pengadaan alat dan perlengkapan keperluan kantor, pencatatan barang-barang inventaris kantor, pengaturan akomodasiperkantoran, pengurusan wisma/mes, pengarsipan

surat menyurat,danperaturan-peraturanperkerta apiandan pelaksanaan bantuan hokum.

5) Kepala Sub Bagian Seksi Kas Besar

Tugasdan tanggungjawabpokok dariKepala SubBagianSeksiKas Besar adalahmelakukan penerimaan/penyimpanan uang dan

atau surat- suratberhargasertapencatatannya, pembukuandanpembuatananalisis penerimaan.

(17)

PT. KeretaApi Indonesia(Persero)DivisiRegionalISumateraUtara merupakanBadanUsahaMilikNegara(BUMN)yang memilikijenisusaha dibidang jasatransportasi,yaitumenyediakanpelayanan transportasipelayanan

transportasiuntuk kepentingan konsumen di daerah Sumatera Utara.

Selainmenyediakan jasa transportasi bagikonsumenataupenumpang,PT.

KeretaApiIndonesia(Persero)jugamenyediakanjasaangkutanbarang,misalnya pengangkutan bahan-bahan mentah, seperti sawit. PT. KeretaApiIndonesia bekerja sama dengan PTPN ataupun perusahaan lainnya yang membutuhkan jasa

angkutanbaranguntuk mengalokasikanbarang-barangtersebutketempatyang telah ditentukan.

E. Usaha Kerja Terkini

PT.KeretaApiIndonesia(Persero)selalumembuatsuatuprogram yang setiaptahunnyaberubahsesuaidengankebutuhanpara konsumennyauntuk

meningkatkan minat para konsumenjasa pemakai Kereta Api. PT.Kereta Apimemilikiusahakerjaterkini, yaitumenjalankansuatu program, sebagai berikut :

1. Keselamatan

PT. Kereta Api berusahameningkatkan keselamatan para penumpangdari tahunketahun,agarkonsumenlebihpercaya

danmenjadikonsumentetap pemakaianjasaPT.KeretaApi (persero)Medan.Saatini PT.Kreta Api (persero) Medansedang melakukanperbaikan relKereta Apidisepanjang jalurKeretaApi.

2. Pelayanan

Setiapmasyarakat,terutamaparakonsumenpemakaijasaPT.KeretaApi

(18)

u PT. Kreta Api(persero)juga menadakan peningkatan pelayanan dengan mendidik para pegawainya untuk memahamipermintaan

penumpang Kereta Api.Saatini

karyawanyangtelahmengikutipelatihansekitarkuranglebih50 orang. 3. Kenyamanan

Disetiap kegiatanataupuntempat,setiap orangpastimembutuhkan kenyamanan,begitu juga parapenumpangkereta api.Makaitulah,PT.Kereta ApiIndonesia(Persero)

berusahameningkatkan kenyamanandisetiapkereta apiagarpenumpangsemakinsemangatmenggunakanjasa

PT.KeretaApi Indonesia (Persero).SaatiniPT. KeretaApiIndonesia (Persero)sedang mengupayakanuntukmeningkatkan kenyamanandenganmenambahfasilitas kebersihan disetiapkeretaapi,

sepertimenyediakantongsampah,sapu,dan kain pembersih disetiapgerbong kereta api dan lain sebagainya.

4. Tepat Waktu

PT.KeretaApiIndonesia(Persero)

sadarbenarbahwaparapenumpangatau pemakai jasanya, sangat

menghargai waktu. Maka, penumpang berharap setiapperjalananmerekadengankeretaapisampaipada tepatwaktu atau sesuaiwaktuyangtelah ditentukan. PT.Kereta ApiIndonesia(Persero)

juga meningkatkan ketepatanwaktu dalam pemberangkatan dan mengurangi waktupemberhentiandisetiap

(19)

waktunya.

F. Rencana Kegiatan

RencanakegiatanPimpinan(KepalaSubBaghian)PT. KeretaApi

Indonesia (Persero)DivisiRegionalSumateraUtarayangakandatangditentukan olehPimpinanPusat. Adapunrencana-rencana kegiatantersebut adalahsebagai berikut:

1. Meningkatkan fasilitas yang dapat membantu bagian Kearsipan untuk memelihara danmengamankanarsip-arsippadakantor

PT.KeretaApi Indonesia(Persero) Divisi Regional ISumatera Utara.

2.

Melakukanpenyuluhan,pelatihandanpendidikanbagipegawa ikearsipan agardapatmeningkatkankinerjapegawaidalam

memeliharadan mengamankan arsip.

3. Melakukan pemisahan arsip-arsip yang aktif dan in-aktif, dengan tempat penyimpananyangsesuaidengan ketentuanpemeliharaan

(20)

BABIV

PENYAJIAN DATA

Penyajiandatapadababiniadalah hasildaripenelitianyang telahdilakukanpada PT. Kereta Api Indonesia Divisi Regional I Sumatera Utara dengancaramenyebarkankuesionerpada responden sebanyak 100

pelanggansebagai sampeldalampenelitianini.Untukmemperolehgambaranyang jelasdari datayang

diperolehdarikuesionertersebut,dibawahinidisajikandatadalamtabel-tabel distribusiyangkemudiandi distribusikan sebagai berikut:

A. KarakteristikResponden

Data identitas responden mencakup distribusi data responden menurut jenis kelamin, usia, pendidikan dan lamabekerja.Berdasarkanhasil penelitianyang

dilakukan, makaidentitas respondendapat diuraikan sebagaiberikut ini :

a. BerdasarkanJenis Kelamin

Tabel 4.1

Distribusi DataResponden Bedasarkan Jenis

Kelamin

NO Responden Jumlah Presentase

1 Laki-Laki 41 41%

2 Perempuan 59 59%

Jumlah 100 100%

Sumber:Hasil Penelitian2016

(21)

dariseluruhresponden yangada denganjumlah100pelanggan,terdapat41pelanggan(41%) ituadalahlaki- lakidan59pelanggan(59%) adalahperempuan.Daritabeldiatasdapat

disimpulkan bahwajumlahpelangganyang datang kePT. KAI Divisi Regional I Sumatera Utaralebihdidominasioleh pelangganyang

berjeniskelamin perempuan.

b. BerdasarkanUsia

Tabel 4.2

Distribusi DataResponden Bedasarkan Usia

NO Responden Jumlah Presentase

1 <20 Tahun 5 5%

2 20-30 Tahun 42 42%

3 31-40 Tahun 25 25%

4 41-50 Tahun 16 16%

5 >51 Tahun 12 12%

Jumlah 100 100%

Sumber:Hasil Penelitian2016

Berdasarkan tabel 2 diatas, dapat dilihat bahwa pelanggan yang hadir di PT. Kereta Api Indonesia Divisi Regional I Sumatera Utaralebihdidominasiolehpelanggan yangberusia20-30tahun yang

berjumlah42pelanggan(42%),lalupelangganyangberusia 31-40tahun ada 25 pelanggan(25%),kemudianpelangganyangberusia 41-50tahunyangberjumlah16

(22)
(23)

c.Berdasarkan Pendidikan Terakhir

Tabel 4.3

Distribusi DataResponden Berdasarkan Pendidikan

Terakhir

NO Responden Jumlah Presentase

1 SD/SMP 2 2%

2 SMA/Sederajat 45 45%

3 Diploma 19 19%

4 Sarjana (S1) 30 30%

5 Pasca Sarjana 4 4%

Jumlah 100 100%

Sumber:Hasil Penelitian2016

Berdasarkan tabel 3diatas, dapat dilihat bahwamayoritas pelanggan

mempunyai pendidikanterakhir SMAyang berjumlah45pelanggan(45%),dan diikutidengan pelangganyang memilikipendidikanterakhirSarjana (S1)yang

berjumlah30pelanggan(30%),pelangganyangmemilikipendidikanterakhirDiplom ayangberjumlah 19 pelanggan (19%), serta pelanggan yang memiliki pendidikan terakhir Pasca Sarjana berjumlah 4 orang (4%) dan pelanggan yang

(24)

d.BerdasarkanPekerjaan

Tabel 4.4

Distribusi DataResponden Berdasarkan Jenis

Pekerjaan

NO Responden Jumlah Presentase

1 Pelajar 3 3%

2 Mahasiswa 40 40%

3 PNS/TNI/PolRI 21 21%

4 Pegawai Swasta 20 20%

5 Lain-Lainnya 16 16%

Jumlah 100 100%

Sumber:Hasil Penelitian2016

Berdasarkantabel4diatas,dapatdilihatbahwapelangganyang

datangpadaPT. Kereta Api Indonesia Divisi Regional I SumateraUtaramayoritasmahasiswa40pelanggan(40%),diikutidenganpelangga

n yangbersatatus sebagai PNS/TNI/PolRI21 pelanggan (21%), lalu diikuti dengan pelanggan yang berstatussebagaiPegawaiSwasta20 pelanggan (20%),danpelangganyang mempunyai pekerjaan yang lain dari 4 kategori

(25)

e. Berdasarkan Lama Menjadi Pengguna Jasa

Tabel4.5

Distribusi Data Responden

BerdasarkanLamaMenjadiPenggunaJasaTransportasiKeretaApi.

NO Lama Jumlah Presentase

1 ≤ 1 tahun 14 14%

2 1-2 tahun 46 46%

3 2-5 tahun 22 22%

4 Lebih dari 5 tahun 18 18%

Jumlah 100 100%

Sumber:Hasil Penelitian2016

Daridatadiatas,dapatdilihatbahwamayoritasmasyarakatyangdigunakan

sebagairespondenmenjadipenggunajasakeretaapi1–2tahundenganjumlah 46 orangatausebesar46%.Kemudian 22respondenatau22%selama2-5

tahun..Sebanyak18orangatausebesar18%

(26)

f. Berdasarkan Apakah Pengguna Jasa Menggunakan Alat Transportasi

Lain

Tabel4.6

Distribusi Data Responden BerdasarkanApakah Pengguna Jasa

Menggunakan Alat Transportasi Lain.

NO Apakah pengguna jasa

menggunakan alattrasportasilain

Jumlah Presentase

1 Ya 64 64

2 Tidak 36 36

Jumlah 100 100%

Sumber:Hasil Penelitian2016

Dari datadiatas,dapatdilihatmayoritasmasyarakatmengunakanalat

trasportasi lain sebanyak 64 orang atau (64%) responden menggunakan jasa trasportasilain, kemudian36orangatau(36%)tidak menggunakanalat transpotasi lain selainkeretaapi.

B. Deskripsi Data Variabel Penelitian

a. KuesionerVariabel X (Kualitas Pelayanan)

Untuk mengukur variabel kualitas pelayanan PT. Kereta Api

Indonesia Divisi Regional I Sumatera

(27)

waban yangtelahdisediakanolehpeneliti.

Berdasarkanjawaban responden darihasilpenyebaran kuesionermaka diperolahdatasebagaiberikut:

Tabel4.7

DistribusiJawabanRespondenTentangSituasi Dan Ruang Tunggu

Stasiun Yang Nyaman

No. Kategori Jumlah Persentase

1 SangatSetuju 24 24%

2 Setuju 58 58%

3 Biasa Saja 18 18%

4 KurangSetuju 0 0

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakan puas dengansituasi dan ruang tunggu stasiun yang nyaman.Dari

hasilkuesionersebanyak58orang(58%)setuju,24orangatau

sebanyak(24%)menyatakan sangat setuju,dan

18orangatausebanyak(18%)menyatakan biasa saja.

Makadapatdisimpulkanbahwafasilitasyang diberikanolehPT. Kereta Api Indonesia seperti: ruang tunggu yang nyaman kepada pelanggan keadaannya sangat baik

(28)

Tabel4.8

DistribusiJawabanRespondenTentangPegawai Kereta Api Memiliki

Penampilan Rapi Dan Profesional

No. Kategori Jumlah Persentase

1 SangatSetuju 32 32%

2 Setuju 38 38%

3 Biasa Saja 29 29%

4 KurangSetuju 1 1%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanpegawai kereta api

memiliki penampilan rapi dan profesional.Dari hasilkuesionersebanyak38orang(38%)setuju,32orangatau

sebanyak(32%)menyatakan sangat

setuju,29orangatausebanyak(29%)menyatakan biasa saja,dan 1orangatau(1%)menyatakankurangsetuju. Dari tabel tersebut dapat

disimpulkan bahwa pegawai PT. Kereta Api (melingkupi petugas kereta api yang bertugas) memiliki penampilan yang rapi dan profesional sehingga pelanggan yang akan merasa percaya bahwa PT. Kereta Api disetiap

(29)

Tabel4.9

DistribusiJawabanRespondenTentangPegawai Kereta Api

Memberikan Pelayanan Tepat Pada Waktunya

No. Kategori Jumlah Persentase

1 SangatSetuju 26 26%

2 Setuju 44 44%

3 Biasa Saja 28 28%

4 KurangSetuju 2 2%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanpegawai kereta api memberikan pelayanan tepat pada waktunya.Dari

hasilkuesionersebanyak44orang(44%)setuju,28orangatau

sebanyak(28%)menyatakanbiasa saja,26orangatausebanyak(26%)menyatakan sangat setuju,dan 2orangatau(2%)menyatakankurangsetuju.

Dari tabel diatas pelanggan setuju dengan pernyataan bahwa pegawai kereta api memberikan pelayanan tepat pada waktunya sehingga para pelanggan tidak membuang waktunya untuk menunggu pelayanan yang diberikan oleh pegawai

PT. Kereta Api dengan percuma, dapatdilihatbahwa pegawai PT.Kereta Apitelah memberikan apa yang mereka bisa didalam menyelesaikan apa yang

(30)

petugas dalam melayani pelanggan tepat pada waktunya.

Tabel4.10

DistribusiJawabanRespondenTentangPegawai Kereta Api Dengan

Tulus Membantu Pelanggan

No. Kategori Jumlah Persentase

1 SangatSetuju 25 25%

2 Setuju 52 52%

3 Biasa Saja 22 22%

4 KurangSetuju 1 1%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanpegawai kereta api dengan tulus membantu pelanggan.Dari

hasilkuesionersebanyak52orang(52%)setuju,25orangatau

sebanyak(25%)menyatakansangat setuju, 22orangatausebanyak(22%)menyatakan biasa saja, dan 1 orang atau sebanyak

(1%) menyatakan kurang setuju.Makadapatdisimpulkanbahwa pegawai PT. Kereta Apitulus adanyakepada pelanggankarena dapatdilihatdaritabeldiatasmenunjukkansudahbaik akan sikap yang diberikan

pegawai kepada pelanggaan, sehingga konsumen sudah merasapuasdengansikapyang merekaterimadarikaryawan.Namuntidakdapat

(31)

Tabel4.11

DistribusiJawabanRespondenTentangPengguna Jasa Tidak Pernah

Menunggu Terlalu Lama

No. Kategori Jumlah Persentase

1 SangatSetuju 23 23%

2 Setuju 52 52%

3 Biasa Saja 24 24%

4 KurangSetuju 1 1%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanpengguna jasa tidak pernah menunggu terlalu lama.Dari

hasilkuesionersebanyak52orang(52%)setuju,24orangatau

sebanyak(24%)menyatakanbiasa saja,23orangatausebanyak(23%)menyatakan

sangat setuju,dan 1orangatau(1%)menyatakankurangsetuju.

Tabel4.12

DistribusiJawabanRespondenTentangSetiap Pertanyaan Pengguna

Jasa Dapat Dijawab Oleh Petugas Kereta Api

No. Kategori Jumlah Persentase

1 SangatSetuju 23 23%

2 Setuju 45 45%

3 Biasa Saja 30 30%

4 KurangSetuju 2 2%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

(32)

jasa dapat dijawab oleh petugas kereta api.Dari hasilkuesionersebanyak45orang(45%)setuju,30orangatau

sebanyak(30%)menyatakan biasa saja,23orangatausebanyak(23%)menyatakan

sangatsetuju,dan 2orangatau(2%)menyatakankurangsetuju. Keakurataninformasiyang diberikan pegawai kepadapelanggan yang memberikan

pertanyaanuntuk ditanggapi ternyata memiliki hasil yang baik dimana ditunjukkanpada tabelbahwa45% para konsumenmenyatakanbaikdidalam informasiyang merekaterima.Tetapiadakonsumenyang masih

merasakurangnyakeakurataninformasi yangdisampaikan kepadamereka, sehinggamerekamasihmenyatakan burukakaninformasi dari pegawai.

Tabel4.13

DistribusiJawabanRespondenTentangKereta Api Berangkat Sesuai

Dengan Jadwal Yang Telah Ditentukan Oleh Pihak Kereta Api

No. Kategori Jumlah Persentase

1 SangatSetuju 20 20%

2 Setuju 51 51%

3 Biasa Saja 29 29%

4 KurangSetuju 0 0%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakankereta api berangkat

sesuai dengan jadwal yang telah ditentukan oleh pihak kereta api.Dari hasilkuesionersebanyak51orang(51%)setuju,29orangatau

(33)

20orangatausebanyak(20%)menyatakan sangat setuju. Dapat disimpulkan bahwa pelanggan sudah merasa puas akan keberangkatan kereta api yang sudah sesuai jadwal yang telah ditentukan oleh pihak kereta api maka pihak kereta api

sudah bekerja dengan baik untuk menginformasikan keberangkatan kereta api kepada pelanggan sehingga pelanggan merasa tidak dirugikan.

Tabel4.14

DistribusiJawabanRespondenTentangPelayanan Yang Diberikan PT.

Kereta Api Sesuai Dengan Kebutuhan Pelanggan

No. Kategori Jumlah Persentase

1 SangatSetuju 22 22%

2 Setuju 55 55%

3 Biasa Saja 20 20%

4 KurangSetuju 3 3%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanpelayanan yang diberikan PT. Kereta Api sesuai dengan kebutuhan pelanggan.Dari

hasilkuesionersebanyak55orang(55%)setuju,22orangatau

sebanyak(22%)menyatakan sangat setuju,20orangatau(20%)menyatakanbiasa saja, dan 3 orang atau (3%) menyatakan kurang setuju. Berdasarkan tabel

tersebut dapat dikatakan bahwa pelanggan sudah merasa puas dengan pelayanan yang telah diberikan oleh PT. Kereta Api karena sesuai dengan kebutuhan

(34)

masih ada yang kurang setuju (sebanyak 3 orang) sehingga PT. Kereta Api harus lebih lagi meningkatkan pelayanannya sehingga semua pengguna jasa merasa puas dengan pelayanan yang diberikan.

Tabel4.15

DistribusiJawabanRespondenTentangPetugas Kereta Api Lebih

Mengutamakan Keselamatan Penumpang

No. Kategori Jumlah Persentase

1 SangatSetuju 25 25%

2 Setuju 43 43%

3 Biasa Saja 32 32%

4 KurangSetuju 0 0%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanpetugas kereta api lebih

mengutamakan keselamatan penumpang.Dari hasilkuesionersebanyak43orang(43%)setuju,32orangatau

sebanyak(32%)menyatakanbiasa saja,dan 25orangatausebanyak(25%)menyatakan

sangat setuju. Dari hasil tersebut menunjukkan bahwa pengguna jasa setuju bahwa sikap dari petugas kereta api yang lebih mengutamakan keselamatan penumpang dibandingkan dengan kepentingan pribadi, hal tersebut perlu

(35)

Tabel4.16

DistribusiJawabanRespondenTentangPengguna Jasa Merasa Aman

Menggunakan Kereta Api Sebagai Alat Transportasi

No. Kategori Jumlah Persentase

1 SangatSetuju 23 23%

2 Setuju 46 46%

3 Biasa Saja 29 29%

4 KurangSetuju 2 2

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanpengguna jasa merasa aman menggunakan kereta api sebagai alat transportasi.Dari

hasilkuesionersebanyak46orang(46%)setuju,29orangatau

sebanyak(29%)menyatakanbiasa saja,23orangatau(23%)menyatakansangatsetuju,

dan 2 orang atau (2%) kurang setuju. Dari data tersebut pelanggan sudah merasa aman menggunakan kereta api sebagai alat transportasi, berarti PT. Kereta Api sebagai penyedia jasa transportasi telah memberikan rasa aman baik dalam segi

kelayakan kendaraan maupun keselamatan penumpang.

Tabel4.17

DistribusiJawabanRespondenTentangPT. Kereta ApiMenyediakan

Kotak Saran Bagi Pelanggan Untuk Menyampaikan Keluhan

No. Kategori Jumlah Persentase

1 SangatSetuju 24 24%

2 Setuju 51 51%

3 Biasa Saja 24 24%

4 KurangSetuju 1 1%

5 TidakSetuju 0 0

(36)

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanPT. Kereta Api menyediakan kotak saran bagi pelanggan untuk menyampaikan keluhan.Dari

hasilkuesionersebanyak51orang(51%)setuju,24orangatau

sebanyak(24%)menyatakan sangat setuju,24orangatausebanyak(24%)menyatakan

biasa saja,dan 1orangatau(1%)menyatakankurangsetuju. Dari tabel diatas dapat disimpulkan bahwa PT. Kereta Api telah menyediakan kotak saran sebagai fasilitas untuk pelanggan dalam menyampaikan keluhannya, namun masih ada

pelanggan yang kurang setuju akan tersedianya kotak saran yang disediakan oleh PT. Kereta Api. PT. Kereta Api harus memeriksa kembali ketersediaan fasilitas

kotak saran bagi pelanggan yang digunakan untuk member kritik dan saran untuk pihak kereta api di setiap stasiun karena sangat berguna untuk membangun dan memberikan motivasi bagi PT, Kereta Api untuk meningkatkan mutu pelayanan

(37)

Tabel4.18

DistribusiJawabanRespondenTentangSetiap Keterlambatan

Diberitahukan Kepada Pelanggan Terlebih Dahulu

No. Kategori Jumlah Persentase

1 SangatSetuju 25 25%

2 Setuju 58 58%

3 Biasa Saja 17 17%

4 KurangSetuju 0 0

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakansetiap keterlambatan akan diberitahukan kepada pelanggan terlebih dahulu.Dari

hasilkuesionersebanyak58orang(58%)setuju,25orangatau

sebanyak(25%)menyatakan sangat setuju,

dan17orangatausebanyak(17%)menyatakan biasa saja. PT. Kereta Api telah melakukan yang terbaik untuk pelanggannya agar pelanggan tidak terlalu kecewa dengan menginformasikan setiap keterlambatan baik untuk keberangkatan maupun

kedatangan sehingga dapat dilihat dari hasil tabel bahwa pelanggan telah diinformasikan terlebih dahulu oleh petugas kereta api tentang setiap keterlambatan yang akan terjadi.

b. KuesionerVariabel Y (Loyalitas Konsumen)

Untukmengukur variabelLoyalitasKonsumendigunakan4indikatoryang kemudian diubah menjadi 10 pertanyaan.Padasetiap pertanyaan terdapat 5 pilihan jawaban, dimana

(38)

diperolahdatasebagaiberikut:

Tabel4.19

DistribusiJawabanRespondenTentangMempertimbangkan Kereta Api

Sebagai Alat Transportasi Pada Pilihan Pertama

No. Kategori Jumlah Persentase

1 SangatSetuju 19 19%

2 Setuju 57 57%

3 Biasa Saja 23 23%

4 KurangSetuju 1 1%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanmempertimbangkan kereta api

sebagai alat transportasi pada pilihan pertama.Dari hasilkuesionersebanyak57orang(57%)setuju,23orangatau

sebanyak(23%)menyatakanbiasa saja,19orangatausebanyak(19%)menyatakan sangat setuju,dan 1orangatau(1%)menyatakankurangsetuju. Dari hasil tabel, sebagian besar menyatakan akan mempertimbangkan kereta api sebagai alat

transportasi pada pilihan pertama, membuktikan loyalitas responden terhadap jasa transportasi kereta api besar karena besar kemungkinan juga pelanggan akan terus menggunakan kereta api secara teratur sehingga membawa dampak baik bagi

perusahaan. Namun dari tabel diatas juga masih terdapat responden yang kurang setuju untuk mempertimbangkan kereta api sebagai alat transportasi sebagai

(39)

Tabel4.20

DistribusiJawabanRespondenTentangMerekomendasikan Kereta Api

Sebagai Alat Transportasi Kepada Keluarga, Teman Ataupun

Kerabat

No. Kategori Jumlah Persentase

1 SangatSetuju 11 11%

2 Setuju 57 57%

3 Biasa Saja 32 32%

4 KurangSetuju 0 0%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanmerekomendasikan kereta

api sebagai alat transportasi kepada keluarga, teman, ataupun kerabat.Dari hasilkuesionersebanyak57orang(57%)setuju,32orangatau

sebanyak(32%)menyatakanbiasa saja,dan 11orangatausebanyak(11%)menyatakan sangat setuju.Dari tabel diatas, pelanggan sudah setuju untuk merekomendasikan kereta api sebagai alat transportasi kepada keluarga, teman, ataupun kerabat yang

memenuhi salah satu indikator dari loyalitas pelanggan yaitu refers other(merekomendasikan kepada orang lain) sehingga baik keluarga, teman,

maupun kerabat daripada responden tertarik untuk menggunakan jasa PT. Kereta

(40)

Tabel4.21

DistribusiJawabanRespondenTentangBerbicara Hal-hal Positif

Mengenai PT. Kereta Api Indonesia

No. Kategori Jumlah Persentase

1 SangatSetuju 15 15%

2 Setuju 64 64%

3 Biasa Saja 21 21%

4 KurangSetuju 0 0

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanberbicara positif mengenai PT. Kereta Api Indonesia.Dari

hasilkuesionersebanyak64orang(64%)setuju,21orangatau

sebanyak(21%)menyatakanbiasa saja, dan

15orangatausebanyak(15%)menyatakan sangat setuju. Menyatakan hal positif mengenai PT. Kereta Api juga merupakan indikator refers other, sehingga oranglain yang belum menggunakan jasa transportasi kereta api berpikiran baik

terhadap PT. Kereta Api dan menciptakan ketertarikan untuk menggunakan jasa PT. Kereta Api, dari data diatas dapat disimpulkan bahwa responden setuju untuk mengatakan hal-hal baik tentang PT. Kereta Api dan akan menimbulkan dampak

(41)

Tabel4.22

DistribusiJawabanRespondenTentangBerniat Untuk Terus

Menggunakan Kereta Api Sebagai Alat Transportasi

No. Kategori Jumlah Persentase

1 SangatSetuju 15 15%

2 Setuju 53 53%

3 Biasa Saja 27 27%

4 KurangSetuju 5 5%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanberniat untuk terus menggunakan kereta api sebagai alat transportasi.Dari

hasilkuesionersebanyak53orang(53%)setuju,27orangatau

sebanyak(27%)menyatakanbiasa saja, dan

15orangatausebanyak(15%)menyatakan sangat setuju, dan 5 orang atau sebanyak (5%) menyatakan kurang setuju. Pelanggan akan terus menggunakan kereta api sebagai alat transportasi, sudah memenuhi salah satu indikator loyalitas pelanggan

yaitu menggunakan jasa secara teratur sehingga pelanggan adalah orang tetap yang menggunakan jasa PT. Kereta Api. Dari hasil tabel dapat dilihat bahwa responden setuju berniat untuk terus menggunakan kereta api sebagai alat

transportasi, namun masih ada sebagian kecil yang kurang setuju dengan pernyataan tersebut sehingga PT. Kereta Api harus kembali mengevaluasi

(42)

Tabel4.23

DistribusiJawabanRespondenTentangMengajak Oranglain Untuk

Menggunakan Kereta Api

No. Kategori Jumlah Persentase

1 SangatSetuju 15 15%

2 Setuju 54 54%

3 Biasa Saja 25 25%

4 KurangSetuju 6 6%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasresponden menyatakanmengajak oranglain untuk

menggunakan kereta api.Dari

hasilkuesionersebanyak54orang(54%)setuju,25orangatau

sebanyak(25%)menyatakanbiasa saja,15orangatausebanyak(15%)menyatakan

sangat setuju, dan sebanyak 6 orang atau sebanyak (6%) menyatakan kurang setuju. Dapat disimpulkan dari jawaban responden bahwa pelanggan akan mengajak oranglain (baik keluarga, teman, ataupun kerabat) untuk menggunakan

kereta api sehingga memunculkan pengguna jasa baru dan mungkin akan menjadi pelanggan tetap PT. Kereta api sehingga berdampak baik untuk perusahaan, namun dari jawaban responden tersebut masih terdapat yang kurang setuju untuk

(43)

Tabel4.24

DistribusiJawabanRespondenTentangTidak Memiliki Keinginan Untuk

Menggunakan Jasa Transportasi Lain

No. Kategori Jumlah Persentase

1 SangatSetuju 18 18%

2 Setuju 50 50%

3 Biasa Saja 30 30%

4 KurangSetuju 2 2%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakantidak memiliki keinginan untuk menggunakan jasa transportasi lain.Dari

hasilkuesionersebanyak50orang(50%)setuju,30orangatau

sebanyak(30%)menyatakanbiasa saja,18orangatausebanyak(18%)menyatakan

sangat setuju, dan 2 orang atau sebanyak (2%) menyatakan kurang setuju. Dari tabel tersebut makadapat disimpulkan bahwa pelanggan tidak ingin menggunakan jasa transportasi selain kereta api, namun tidak dipungkiri masih ada pelanggan

yang akan menggunakan jasa transportasi lainnya.

Tabel4.25

DistribusiJawabanRespondenTentangManfaat Yang Diterima Menggunakan

Kereta Api Sesuai Dengan Biaya Yang Dikeluarkan

No. Kategori Jumlah Persentase

1 SangatSetuju 18 18%

2 Setuju 45 45%

3 Biasa Saja 30 30%

(44)

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanmanfaat yang diterima menggunakan kereta api sesuai dengan biaya yang dikeluarkan.Dari

hasilkuesionersebanyak45orang(45%)setuju,30orangatau

sebanyak(30%)menyatakanbiasa saja,18orangatausebanyak(18%)menyatakan sangat setuju, dan 7 orang atau sebanyak (7%) menyatakan kurang setuju.

Pelanggan merasa setuju dengan manfaat yang setara dengan biaya yang dikeluarkan untuk menggunakan jasa transportasi PT. Kereta Api dan tidak

merasa dirugikan karena biaya yang tidak sepadan, tetapi masih ada beberapa orang yang masih keberatan dengan biaya yang dikeluarkan untuk jasa kereta api.

Tabel4.26

DistribusiJawabanRespondenTentangPelanggan Bersedia Menganggarkan

Biaya Rutin Untuk Menggunakan Jasa PT. Kereta Api

No. Kategori Jumlah Persentase

1 SangatSetuju 20 20%

2 Setuju 54 54%

3 Biasa Saja 22 22%

4 KurangSetuju 4 4%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanbersedia menganggarkan

(45)

sebanyak(22%)menyatakanbiasa saja,20orangatausebanyak(20%)menyatakan sangat setuju, dan 4 orang atau sebanyak (4%) menyatakan kurang setuju. Pelanggan merasa perlu untuk menganggarkan biaya rutin untuk menggunakan

jasa PT. Kereta Api hal ini disebabkan karena pelanggan telah merasa bahwa menggunakan jasa kereta api adalah merupakan kegiatan rutin.

Tabel4.27

DistribusiJawabanRespondenTentangPelanggan Ingin Ada Rasa

Keterbukaan Antara Pegawai Dan Juga Pelanggan

No. Kategori Jumlah Persentase

1 SangatSetuju 19 19%

2 Setuju 46 46%

3 Biasa Saja 31 31%

4 KurangSetuju 4 4%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakanpelanggan ingin adanya rasa saling keterbukaan antara pegawai dan pelanggan.Dari

hasilkuesionersebanyak46orang(46%)setuju,31orangatau

sebanyak(31%)menyatakanbiasa saja, 19 orang atau sebanyak (19%) menyatakan sangat setuju dan 4orangatausebanyak(4%)menyatakan biasa saja.Pernyataan ini

merupakan sebuah saran dari pelanggan untuk menciptakan suasana yang baik untuk ke depannya bagi PT. Kereta Api sehingga pelanggan merasa nyaman dan

(46)

Tabel4.28

DistribusiJawabanRespondenTentangPelanggan Tidak Ingin

Dibeda-bedakan

No. Kategori Jumlah Persentase

1 SangatSetuju 17 17%

2 Setuju 42 42%

3 Biasa Saja 38 38%

4 KurangSetuju 3 3%

5 TidakSetuju 0 0

Jumlah 100 100%

Sumber :Hasil Penelitian2016

Dari datadiatas,mayoritasrespondenmenyatakantidak ingin dibeda-bedakan.Dari hasilkuesionersebanyak42orang(42%)setuju,38orangatau

sebanyak(38%)menyatakanbiasa saja,17orangatausebanyak(17%)menyatakan sangat setuju, dan 3 orang atau sebanyak (3%) menyatakan kurang setuju. Dari

(47)

BABV

ANALISISDATA

A.Analisis Data

Penelitianiniberisikantentang PengaruhKualitas Pelayanan Publik Terhadap

Loyalitas Pelanggandanpenelitian iniberlokasidiStasiun Kereta Api Medan, Jalan

Stasiun Kereta Api nomor 1 Medan.Adapun yang

dijadikanrespondendalampenelitianiniadalahpelanggan pengguna jasa kereta api di

Stasiun Kereta Api Medan.Karena keterbatasan waktu, tenaga, dan pemilihan alat analisis maka tidak semua pelanggan di stasiun menjadi sampel

penelitian.Penarikan sampel dalam penelitian ini adalah accidental samplingyaitu responden yang secara kebetulan bertemu dengan peneliti bila dipandang cocok sebagai sampel, dan jumlah sampel yang diambil peneliti adalah sebanyak 100

orang responden.

a.Kualitas Pelayanan

Kualitas pelayanan, adalah suatu bentuk penilaian pelanggan terhadaptingkat pelayanan yangditerima(perceived service)dan tingkat pelayanan yangdiharapkan (expected service) dari segalaaktivitasyang

dilakukansuatuperusahaanatauorganisasi. Dimanaindikatordari kualitas pelayanan tersebut antaralain Tangible, Realiability, Responsiveness,

Assurance, dan Empathy.

(48)

makatahapselanjutnyadilakukananalisisdata tentang variabelkualitaspelayanan berdasarkanlimakarakteristikyang diambildidalampenelitianini. Dalampenelitian ini untukmengukur kualitas pelayanan dibagi menjadi duabelas (12) pertanyaan.

Untuk menentukan jarak interval makadigunakan rumus:

Interval

Intervaltersebutdapatdigunakanuntukmenyusun kategori sebagai berikut:

Untuk kategori sangat tinggi : 46,1633–52,9112 Untuk kategori tinggi : 39,4153 – 46,1632

Untuk kategori sedang : 32,6673 –39,4152 Untuk kategori rendah : 25,9193–32,6672

Untuk kategori sangat rendah : 19,1713–25,9192

UntukmengetahuibesarkualitaspelayananyangadadiPT.Kereta Api Indonesia Divisi Regional I Sumatera Utara,dapat dilihat dari rekaptulasi jawaban responden

(49)

Tabel 5.1

Rekaptulasi KlasifikasiJawabanResponden BerdasarkanKualitas Pelayanan

Kategori Interval Frekuensi Persentase(%)

Sangat Tinggi 46,1633– 52,9112 12 12

Tinggi 39,4153 – 46,1632 33 33

Sedang 32,6673 – 39,4152 27 27

Rendah 25,9193 – 32,6672 23 23

Sangat Rendah 19,1713 – 25,9192 5 5

Jumlah 100 100

Sumber :Hasil Penelitian 2016

Berdasarkantabel5.1diatasdapatdilihatbahwakualitaspelayanandi PT. Kereta Api Indonesia Divisi Regional I Sumatera Utaraberadadikategoritinggi,yang ditunjukkan

dari33responden (33%), kategori sedang sebanyak 27 responden (27%), kategori rendah sebanyak 23 responden (23%), kategori sangat tinggi sebanyak 12responden (12%),

danyangterakirkategori sangat rendah 5responden (5%).

b.LoyalitasPelanggan

Loyalitaspelangganadalahkesetiaanyang diberikanolehpelangganakibat pelayananyangtelahditerimaterhadapkinerjaatauhasildarisuatupelayananyang

sesuaidenganharapan.Dimanaindikatorloyalitaspelangganantara lainMakesregular

repeatpurchases(melakukanpembeliansecara teratur),Purchasesacrossproductand service

(50)

Demonstrate an immunity to the full of the competition (menunjukkan

kekebalanterhadap tarikan dari pesaing-pesaing).

Setelahkeseluruandatadiperolehdansudahdiuraikandidalampenelitianini,

makatahapselanjutnyadilakukananalisisdatatentang variabelloyalitaspelanggan

berdasarkanempatkarakteristikyang diambildidalampenelitianini.Dalampenelitianini untukmengukurloyalitasdibagimenjadisepuluh (10)pertanyaan.Untukmenentukanjarak

interval makadigunakanrumus:

Interval

Intervaltersebutdapatdigunakanuntukmenyusun kategori sebagai berikut:

Untuk kategori sangat tinggi : 39,6332–45,152 Untuk kategori tinggi : 34,1143–39,6331 Untuk kategori sedang : 28,5954 –34,1142

Untuk kategori rendah : 23,0765–28,5953 Untuk kategori sangat rendah : 17,5579–23,0764

Untukmengetahuibesarloyalitas pelanggan yangadadiPT.Kereta Api Indonesia

(51)

Tabel 5.2

Rekaptulasi KlasifikasiJawabanResponden Berdasarkan Loyalitas Pelanggan

Kategori Interval Frekuensi Persentase(%)

Sangat Tinggi 39,6332 – 45,152 6 6%

Tinggi 34,1143 – 39,6331 18 18%

Sedang 28,5954 – 34,1142 35 35%

Rendah 23,0765 – 28,5953 32 32%

Sangat Rendah 17,5579 – 23,0764 9 9%

Jumlah 100 100%

Sumber :Hasil Penelitian 2016

Berdasarkan tabel 5.2dapat dilihat bahwa loyalitas para pelangganPT Kereta Apisedang,yangditunjukkandari35pelanggan(35%),kategorirendah32pelanggan(32%),dan dikategoritinggiada18pelanggan(18%),sangat rendahada9pelanggan(9%)dandikategori

sangat tinggiada6pelanggan(6%).

c. PengaruhKualitas Pelayanan TerhadapLoyalitas Pelanggan

Untukmengetahuiapakahada hubunganantara kualitaspelayananterhadap loyalitaspelanggan,maka

dapatdilihatdenganmenggunakanrumusproductmoment.Sedangkan untukmenguji

apakahdiantara kualitas pelayanandenganloyalitas

(52)

digunakanrumuskoefisiendeterminan.Sedangkanregresilinier sederhana digunakan untuk melihat pengaruh antarakualitas pelayanan terhadap loyalitas pelanggan.

a. ProductMoment

Untuk mengetahuiapakah ada hubungan kualitas pelayanan terhadap loyalitas pelanggan

padaPT. Kereta Api Indonesia makadigunakan rumus product moment:

(53)

923 , 449735

9 , 328136 =

xy r

7296 , 0

=

xy

r

Hasil perhitungan korelasi tersebut yaitu 0,7296, berarti ada hubungan positif antara kualitas pelayanan terhadap loyalitas pelanggan PT. Kereta Api Divisi Regional I Sumatera Utara. Dari perhitungan korelasi sebelumnya perlu disesuaikan dengan nilai

tabel. Dari perhitungan korelasi diatas diperoleh nilai rhitung0,7296 bila dikonsultasikan dengan nilai rtabel untuk n = 100 dan kesalahan 5%, maka rtabel adalah 0,195. Dengan demikian korelasi tersebut signifikan, karena rhitung> rtabel.

Dari perhitungan hasil yang menggunakan rumus koefisien korelasi product momentmaka diperoleh hasil r = 0,7296, dapat disimpulkan bahwa dengan adanya

kualitas pelayanan memberi pengaruh positif terhadap loyalitas pelanggan di PT. Kereta

Api Divisi Regional I Sumatera Utara. Dengan kata lain apabila salah satu variabel terjadi peningkatan maka akan dikuti dengan peningkatan variabel yang berkorelasi.

Untukmengetahuikadar lemahkuatnya koefisienkorelasi,maka diperlukan

(54)

Tabel 5.1

Tabel KoefisienKorelasi

Interval koefisien Tingkat Hubungan

Antara0,00-0,199 Sangat rendah

Antara0,20-0,399 Rendah

Antara0,40-0,599 Sedang

Antara0,60-0,799 Tinggi

Antara0,80-1,000 Sangat tinggi Sumber :Sugiyono(2005:214)

Selain itu, dengan mengkonsultasikan ryang diperoleh dengan tabelpedoman interpretasi Sugiyono,maka dapatdilihatbahwa r = 0,7296berada pada interval

koefisien0,60–0,799.Jaditingkathubunganantara variabelXdanVariabelY berada pada kategoritinggi.Berarti hubunganantaraKualitas Pelayanan(X)terhadapLoyalitas

Pelanggan(Y)adalahberada padatingkat tinggi.

b. UjiSignifikan(Uji t)

UntukmengujisignifikanantaravariabelXdanvariabelYdapatdilakukandengan menggunakan rumus:

(55)

5323

Harga thitung adalah 10,562 dan jika dilihat pada tabel t (lihat lampiran)

untuk kesalahan 5% dan dk = 100-2 = 98, maka didapat ttabel =1,67. Berdasarkan

ketentuan hipotesis:

a. Jikahargathitung>ttabel,maka Ho(hipotesa Nol)ditolakdanHa

(hipotesa Alternatif)diterima,artinyaada pengaruhsignifikan antara kualitaspelayananterhadaployalitaspelangganpada PT. Kereta Api Indonesia Divisi Regional I Sumatera Utara

b. Jika hargathitung<ttabel,makaHo (hipotesaNol)diterimadan Ha

(hipotesaAlternatif)ditolak,artinya tidak ada pengaruh signifikanantara kualitaspelayananterhadap loyalitas

pelanggan padaPT.Kereta Api Indonesia Divisi Regional I Sumatera Utara

Denganmembandingkanantara

(56)

thitung>ttabel( 10,562>1,67),haliniberartiHoditolakdanHa diterima. Dengan

demikianterdapatpengaruh antara kualitas pelayananterhadap loyalitas pelanggan pada PT. Kereta Api Indonesia Divisi Regional I Sumatera Utara.

c. KoefisienDeterminan

Tujuankoefisien determinaninimengetahuipersentasebesarnyapengaruhvariabel X terhadapvariabel Yyang dapat dilakukan dengan menggunakanrumus:

D=(rxy)2x 100%

Dengan persamaan determinasi maka diperoleh hasil sebesar 53,23%. Ini berarti pencapaian loyalitas pelanggan pada PT. Kereta Api Indonesia Divisi Regional I Sumatera Utara dipengaruhi oleh adanya kualitas pelayanan sebesar 53,23% sedangkan sisanya

dipengaruhi faktor-faktor lain yang tidak dibahas dalam penelitian ini yakni sebanyak 46,77%.

d. RegresiLinierSederhana

Analisis regresilinier sederhana dilakukan bila hubungan dua variabel berupa hubungankausal/sebabakibatataufungsional.Analisisregresilinier sederhana juga

digunakanuntukmelihatbagaimana variabelindependen(X) mempengaruhivariabeldependen(Y).Untukmengujiregresilinier sederhana antaravariabel X denganvariabel Y, makadigunakan rumus sebagai berikut :

(57)

2

Berdasarkanperhitunganregresilinier sederhana,nilaikualitas pelayanan

publikdanloyalitas pelangganY= 5,7345+ 0,651X. Hasildari persamaan regresi diatasmempunyai makna:

(58)

publik tetap(X=0) maka perubahanloyalitas pelanggansebesar5,7345atau 6%.Koefisienregresibernilai0,651mengakibatkan kualitas pelayanan publik berpengaruhpositifterhadap loyalitas pelanggan.Nilaiini menunjukanbahwa

setiapadanyaupaya penambahansatusatuanpada kualitas pelayanan publikatauvariabelX ditingkatkan 100%makaloyalitas pelangganakan bertambah sebesar0,651.

Daripenjelasandiatas,dapatdisimpulkanbahwa signifikandanbersifat positif antara

kualitas pelayanan publik denganloyalitas pelanggan padaPT. Kereta Api Indonesia (Persero) Divisi Regional I Sumatera Utara.

B.Pembahasan Hasil Penelitian

Berdasarkan penelitian yang dilakukan oleh Tia Indrianiyang berjudul PengaruhKualitas Pelayanan dan Harga Tiket Terhadap Loyalitas Pelanggan Kereta Api

Kota Bandungyang hasilnyaadalah kualitas pelayanan dan harga tiketterhadaployalitas pelangganbelum cukupberjalan denganbaikyang sesuaidengankuesioneryang

dibagikannyasecara langsung kepada responden yaitu pengguna jasa kereta api rute Bandung - Cirebon. Penelitianinijuga masih menunjukkanpengaruhyang belum signifikanantara kualitas pelayanan dan harga tiket terhadap loyalitas pelanggan jasa

kereta api, berdasarkankuesioneryangdibagikannyahanyadapat 0,23%pengaruhnyadan darideterminasiyaitusebesar 5,47%yangmenunjukkan rendahnya pengaruhantara

variabelkualitas pelayanandanharga tiketterhadap loyalitas pelanggan.

(59)

pada posisikategoritinggi,danloyalitas pelangganberada pada posisikategori sedang.Hasilperhitungan korelasiProduct Momentyang didapat sebesar 0,7296bernilai positif,berarti ada hubungan antara kualitas pelayanan publik terhadap loyalitas

pegawai padaPT. Kereta Api Indonesia (Persero) Divisi Regional I Sumaera Utara danmempunyai pengaruh yang signifikan antara kualitas pelayanan publik terhadap

loyalitas pelanggan PT. KAI Divisi Regional I Sumatera Utara.

Persamaanpenelitianterdahuludenganpenelitianyang penulislakukanadalah sama-sama inginmelihatbagaimana pengaruh kualitas pelayanan terhadap loyalitas

pelanggan.Perbedaannyaadalah pada lokasi,waktu,populasidan sampel padapenelitiannya.Kajian terhadap penelitian terdahulumaupun penelitianyang akan

dilakukan selanjutnyayang mengacukepadateoriyang samadantempatyang samamaupun tempatberbedayang dilakukanpenelitiandalamrangkamemperkuatdatadan informasi serta teori-teori yang berkaitan dengan kualitas pelayanan.Penelitianyang

penulislakukanadalahmeningkatdari penelitian sebelumnyayang dilakukanolehTia IndrianidenganjudulPengaruh Kualitas Pelayanan dan Harga Terhadap Loyalitas Pelanggan Jasa Kereta Api (Survei Pada Penumpang Kereta Api Ciremai Ekspress Rute

Bandung – Cirebon).Hasilpenelitianyangpenulis lakukandenganjudulyang

samatapidenganlokasiyang berbedamenunjukkan bahwa

(60)

BAB VI

PENUTUP

A. Kesimpulan

Berdasarkan hasil penelitian yang dilakukan tentang pengaruh Kualitas

Pelayanan TerhadapLoyalitasPelangganpada PT. Kereta Api Indonesia (Persero) Divisi Regional I Sumatera Utara, maka dapat ditarik kesimpulan sebagai berikut:

1. Bahwaterdapatpengaruhyangpositifantarakualitaspelayananterhadap loyalitas pelanggan,akan tetapipemahaman dan penerapanakankualitas

pelayananharusterusdilakukan.Karena semakinbaiknya pemahamandan penerapan akankualitas diPTPT. Kereta Api Indonesia (Persero) Divisi Regional I Sumatera Utara maka akan semakin baik dan tinggi pula

angkaloyalitas pelanggannya.

2.Kualitas Pelayananyang ada di PT. Kereta Api Indonesia (Persero) Divisi Regional I Sumatera Utara sudah dilaksanakan

dengancukupbaikolehsetiappara pegawai,namunharusterus dipertahankandandimaksimalkanakankualitasnya.Halinidibuktikan oleh hasilpenelitianyang menunjukkanbahwakualitaspelayananberadapada

kategoritinggiberdasarkanjawaban respondenyangberjumlah33orang (33%)dari total respondenyangberjumlah 100 orang (100%).

(61)

denganbaik.Halinidibuktikan oleh hasilpenelitian yangmenunjukkanbahwa loyalitaskonsumenberadapadakategorisedang berdasarkanjawaban respondenyang berjumlah35 orang (35%) daritotal

respondenyang berjumlah100orang (100%)danjugahasiljawaban respondenkeseluruhanmenilaibahwa kualitaspelayanantelahterlaksana

cukup baik dan berkualitas.

4. Berdasarkanpenelitianyangpenulislakukanmelaluianalisiskuesioner yang disebarkanmenunjukkanbahwakualitas pelayanan terhadaployalitas

pelanggan pada PT. Kereta Api Indonesia (Persero) Divisi Regional I Sumatera Utara mempunyai pengaruhyangsignifikan.

B. Saran

Berdasarkanpenelitianyangtelahdilakukan,makapenulisdapatmemberikan saransebagai berikut :

1.Dari segi kualitas pelayanan, hal yang perlu ditingkatkan adalah dalam

memahami danmenerapkan kualitas pelayanan tersebut. Masih banyak pelangganyangmengeluhkanakanketepatanwaktuyangtelahdijanjikan

parapegawaiyang masihbelumsesuai dengankesepakatanyangdiberikan

kepada pelanggan.Olehkarena itudapatdiperhatikanlagiakanketepatan waktuyang telahdijanjikandenganpelangganagarsesuaidenganapayang telah

diberikan.

2.Darisegiloyalitaspelangganhalyangperluditingkatkanadalahkualitas

(62)

Kereta Apiinidapatdilakukandenganmempertahankanapayang sudahada sebelumnyasepertidengansikapramah yangditunjukkanolehpegawai kepada pelangganyang datang untuk mengeluhkan apa yang menjadi kendala bagi

mereka, serta berpenampilan baik dan menarik, dan dapat mengertiapayang menjadikebutuhandanmenanggapiapayang menjadi keluhan parapelanggan

(63)

BAB II

METODE PENELITIAN

A. Bentuk Penelitian

Metode penelitian yang dipergunakan dalam penelitian ini adalah analisis regresi.Regresi merupakan suatu alat ukur yang juga dapat digunakan untuk

mengukur ada atau tidaknya korelasi antarvariabel.Analisis regersi berguna untuk mendapatkan hubungan fungsional antara dua variabel atau lebih.Selain

itu analisis regresi berguna untuk mendapatkan pengaruh antar variabel prediktor terhadap variabel kriteriumnya atau meramalkan pengaruh variabel

prediktor terhadap variabel kriteriumnya (Usman & Akbar, 2006).

B. Lokasi Penelitian

Penelitian ini berlokasi di PT. Kereta Api Indonesia (Persero) Divisi

Regional I Sumatera Utara, Jalan Prof. H.M. Yamin, S.H. No.44 Medan dan Stasiun Kereta Api Medan di Jalan Stasiun Kereta Api no.1 Medan.

C. Populasi dan Sampel

a. Populasi

MenurutSugiyono(2013:80)yang dimaksuddenganpopulasiadalahwilayah

(64)

PT. Kereta Api Indonesia (Persero) Divisi Regional I Sumatera Utara,baikpenumpang kereta api, maupun pelanggan penitipan barang.Jumlahpopulasikuranglebih berjumlah1.500orang/hari.

Karenaketerbatasanwaktu,tenaga,danpemilihanalatanalisisdalampenelitian inimakatidaksemuapopulasidapatdijadikansampelpenelitian.

` b. Sampel

Metode pemilihansampel yang digunakan adalah accidental sampling/sampling incidental, Menurut Sugiyono (2009:122)adalah

“Teknikpenentuansampel berdasarkankebetulan/insidental,yaitusiapa saja yang secarakebetulanbertemudenganpeneliti dapatdigunakansebagaisampelbila dipandang orangyang

kebetulanditemuicocoksebagai sumber data”. Penentuanjumlahsampeldalam penelitian ini ditentukan dengan rentang waktu selama 1 minggu.

D. Teknik Pengumpulan Data

Dalam peneliti ini penulis menggunakan dua macam data menurut

klasifikasi jenis dan sumbernya, yaitu:

a. TeknikPengumpulan DataPrimer.

Yaitu,teknikpengumpulandatayangdilakukansecara langsungpada lokasipenelitiansesuaidenganmasalahyang diteliti.Pengumpulandata

primer dilakukan dengancara:

1. Wawancara(Interviews)

Yaitu,teknikpengumpulandata dengansebuahpercakapan

(65)

penelitikepada subjek ataukelompoksubjekpenelitianuntuk dijawab.

2. Kuesioner(Quitionary)

Yaitu,teknikpengumpulandatayang dilaksanakandengancara menyebarkan daftar pertanyaan yang dilengkapi dengan beberapa

alternatifjawabanyangsudahtersedia.

3. Observasi(Observation)

Yaitu,kegiatanmengamatisecaralangsung denganmencatat

gejala-gejalayang ditemukandilapangan sertamenjaringdata yangtidakterjangkau

b. TeknikPengumpulan DataSekunder.

Yaitu, pengumpulan datadan informasiyangdiperlukan/diperoleh melaluicatatan-catatantertulis lainnyayang berkaitan denganmasalahyang

diteliti.

1) PenelitianKepustakaan (Libraryresearch)

Yaitu,pengumpulandatayang diperolehdaribuku-buku,karyailmiah, pendapatparaahliyang memilikirelevansidenganmasalahyang diteliti.

2) Studi Dokumentasi (Documentary)

Yaitu,teknikyang digunakan dengan menelaahcatatantertulis, dokumen,arsipyangmenyangkutmasalahyang ditelitiyang

(66)

E. Metode Penentuan Skor

Untuk membantu dalam menganalisa data yang diperoleh dalam penelitian, maka penelitian ini menggunakan teknik penentuan skor. Teknik

penentuan skor yang akan digunakan adalah dengan skala ordinal untuk menilai jawaban kuesioner responden. Adapun skor yang ditentukan untuk setiap

pertanyaan adalah :

1. Untuk alternative jawaban A diberi skor 5 2. Untuk alternative jawaban B diberi skor 4

3. Untuk alternative jawaban C diberi skor 3 4. Untuk alternative jawaban D diberi skor 2

5. Untuk alternative jawaban E diberi skor 1

Untuk mengetahui atau menentukan kategori jawaban responden dari masing-masing variabel apakah tergolong tinggi, sedang atau rendah maka

terlebih dahulu ditentukan skala interval dengan cara sebagai berikut :

ilangan

Maka diperoleh:

n = 0,80

Sehingga dengan demikian dapat diketahui kategori jawaban responden

masing-masing variabel yaitu :

(67)

Skor untuk kategori tinggi = 3.41 – 4.20

Skor untuk kategori sedang = 2.61 – 3.40

Skor untuk kategori rendah = 1.81 – 2.60

Skor untuk kategori sangat rendah = 1.00 – 1.80

Untuk menentukan jawaban responden tersebut tergolong sangat tinggi, tinggi, sedang, rendah, sangat rendah maka dari jumlah skor dari variabel akan ditentukan

rata-ratanya dengan membagi jumlah pertanyaan. Dari hasil pembangian tersebut, maka akan dapat diketahui jawaban responden termasuk kedalam kategori yang

mana.

F. Teknik Analisa Data

Teknik analisis data adalah suatu proses pengolahan data yang telah

dikumpulkan sebelumnya. Penetapan teknik analisis data harus tepat agar dapat memberikan suatu output kesimpulan yang benar dan akurat. Analisis-analisis

data yang digunakan ini adalah analisis kuantitatif yang digunakan untuk menguji hubungan/pengaruh antara variabel bebas dan variabel terikat dengan penghitungan statistik.

a. KoefisienKorelasiProduct Moment

Teknikanalisa inidigunakanuntukmengetahuiada tidaknya dantinggi

rendahnyahubunganantar variabelbebas(X)dengan variabelterikat(Y) (Sugiyono, 2005: 212). Caraperhitungannyamenggunakan rumus sebagai berikut:

(68)

Keterangan:

rxy=Koefisien korelasi antaragejalaxdany N=Jumlah Sampel

∑x=Jumlah skor x

∑y=Jumlah skory

∑xy=Jumlah hasilkaliantaraxdany

Untuk melihathubungan antara kedua variabel dari hasil perhitungan, maka dapatdirumuskandenganmemberikantiga

kemungkinanmengenai hubunganantarakeduavariabelyaitu :

a. Nilai rxy positif artinyakedua variabel menunjukkan

hubungan positif dimanakenaikan nilai variabel pertama

diikuti dengan variabelyanglain.

b. Nilai rxy negatif artinya kedua variabel menunjukkan

hubungan negatif dimana kenaikan nilai variabel

pertama diikuti oleh turunnya variabel kedua.

c. Nilai r sama dengan nol artinya kedua variabel tidak menunjukkan hubungan dimanavariabel pertamatetap

meskipun variabel lain berubah.

Untukmengetahuiadanyahubunganyang

tinggiataurendahantarakedua variabelberdasarkannilair (koefisien korelasi)digunakanpenafsiranatau interpretasi angka(Sugiyono, 2005 :

Figur

Tabel 4.1
Tabel 4 1. View in document p.20
Tabel 4.2
Tabel 4 2 . View in document p.21
Tabel 4.3
Tabel 4 3 . View in document p.23
Tabel 4.4
Tabel 4 4 . View in document p.24
Tabel 5.1
Tabel 5 1. View in document p.49
Tabel 5.2
Tabel 5 2 . View in document p.51
Tabel KoefisienKorelasi
Tabel KoefisienKorelasi . View in document p.54

Referensi

Memperbarui...

Unduh sekarang (119 Halaman)