• Tidak ada hasil yang ditemukan

Kajian Semiotik Sajak Kupu Malam Dan Biniku Karya Chairil Anwar

N/A
N/A
Protected

Academic year: 2021

Membagikan "Kajian Semiotik Sajak Kupu Malam Dan Biniku Karya Chairil Anwar"

Copied!
54
0
0

Teks penuh

(1)

Kajian Semiotik Sajak Kupu Malam dan

Kajian Semiotik Sajak Kupu Malam dan

Biniku karya

Biniku karya

Chairil Anwar 

Chairil Anwar 

KUPU MALAM SEBAGAI SIMBOL A!I"A #ALA!G KUPU MALAM SEBAGAI SIMBOL A!I"A #ALA!G PA$A

PA$A SA#AK KUPU SA#AK KUPU MALAM $A! MALAM $A! BI!IKU KA%&A C'AI%IL ABI!IKU KA%&A C'AI%IL A!A%(!A%( Oleh)

Oleh)  Arni &  Arni &anti*anti*  A+,trak  A+,trak

"uli,

"uli,an ini an ini men-kaji ,ajak .Kupu Malam men-kaji ,ajak .Kupu Malam dan Biniku/ karya Chairil Anwar ,e0ara ,emiotik1 "ujuan kajiandan Biniku/ karya Chairil Anwar ,e0ara ,emiotik1 "ujuan kajian ,emiotik ,ajak ini adalah untuk mendapatkan makna

,emiotik ,ajak ini adalah untuk mendapatkan makna ,ajak ,epenuhnya1 Sajak merupakan ,truktur tanda2,ajak ,epenuhnya1 Sajak merupakan ,truktur tanda2 tanda yan- +ermakna dan

tanda yan- +ermakna dan +er,i,tem ,ehin--a pem+erian makna akan le+ih len-kap +er,i,tem ,ehin--a pem+erian makna akan le+ih len-kap jika dikaitkanjika dikaitkan den-an pen--alian makna dari ,etiap kata2kata

den-an pen--alian makna dari ,etiap kata2kata dalam ,ajak ter,e+ut1 Metode ,emioti0 dalam anali,i, inidalam ,ajak ter,e+ut1 Metode ,emioti0 dalam anali,i, ini dilakukan den-an 0ara men-anali,i, +aha,a yan-

dilakukan den-an 0ara men-anali,i, +aha,a yan- dimulai den-an men-anali,i, a,pek ,intak,i,3dimulai den-an men-anali,i, a,pek ,intak,i,3 men-anali,i, a,pek ,emantik3 kemudian men-anali,i, a,pek pra-matik yan- terdapat dalam ,ajak

men-anali,i, a,pek ,emantik3 kemudian men-anali,i, a,pek pra-matik yan- terdapat dalam ,ajak .Kupu.Kupu Malam dan Biniku/ karya Chairil Anwar1

Malam dan Biniku/ karya Chairil Anwar1

Kata Kun0i) anali,i,3 +aha,a3 ,emiotik3 ,intak,i,3 ,emantik3

Kata Kun0i) anali,i,3 +aha,a3 ,emiotik3 ,intak,i,3 ,emantik3 pra-matik1pra-matik1 (1 Pendahuluan

(1 Pendahuluan

Pui,i ,e+a-ai karya ,eni puiti,3 men-andun- nilai keindahan

Pui,i ,e+a-ai karya ,eni puiti,3 men-andun- nilai keindahan yan- khu,u,1 Kepuiti,an itu dapat di0apaiyan- khu,u,1 Kepuiti,an itu dapat di0apai den-an +erma0am2ma0am 0ara3 mi,alnya den-an +entuk 4i,ual) tipo-ra5i3 ,u,unan +ait6 den-an

den-an +erma0am2ma0am 0ara3 mi,alnya den-an +entuk 4i,ual) tipo-ra5i3 ,u,unan +ait6 den-an +unyi)+unyi) per,ajakan3 a,onan,i3 alitera,i3 kia,an +unyi3 lam+an- ra,a3 dan orke,tra,i6 den-an pemilihan kata per,ajakan3 a,onan,i3 alitera,i3 kia,an +unyi3 lam+an- ra,a3 dan orke,tra,i6 den-an pemilihan kata 7dik,i83 +aha,a kia,an3 ,arana retorika3 un,ur2un,ur ketata+aha,aan3 -aya +aha,a3 dan

7dik,i83 +aha,a kia,an3 ,arana retorika3 un,ur2un,ur ketata+aha,aan3 -aya +aha,a3 dan ,e+a-ainya1,e+a-ainya1 $alam men0apai kepuiti,an itu penyair memeper-unakan +anyak 0ara ,ekali-u,3

$alam men0apai kepuiti,an itu penyair memeper-unakan +anyak 0ara ,ekali-u,3 ,e0ara +er,amaan,e0ara +er,amaan untuk mendapatkan jarin-an e5ek puiti, yan-

untuk mendapatkan jarin-an e5ek puiti, yan- ,e+anyak2+anyaknya 7Alten+ernd3 (9:;)<2=83 yan- le+ih,e+anyak2+anyaknya 7Alten+ernd3 (9:;)<2=83 yan- le+ih +e,ar daripada pen-aruh +e+erapa komponen

+e,ar daripada pen-aruh +e+erapa komponen ,e0ara terpi,ah pen--unaannya1 Antara un,ur pernyataan,e0ara terpi,ah pen--unaannya1 Antara un,ur pernyataan 7ek,pre,i83 ,arana kepuiti,an3 yan- ,atu den-an lainnya

7ek,pre,i83 ,arana kepuiti,an3 yan- ,atu den-an lainnya ,alin- mem+antu3 ,alin- memperkuat den-an,alin- mem+antu3 ,alin- memperkuat den-an ke,ejajarannya ataupun pertentan-annya3 ,emuanya itu untuk mendapatkan kepuiti,an ,ee5ekti5 ke,ejajarannya ataupun pertentan-annya3 ,emuanya itu untuk mendapatkan kepuiti,an ,ee5ekti5 mun-kin3 ,einten,i5 mun-kin1

mun-kin3 ,einten,i5 mun-kin1  Alat untuk menya

 Alat untuk menyampaikan pera,aan dan pikimpaikan pera,aan dan pikiran ,a,trawan adalaran ,a,trawan adalah +aha,a1 Penyair tah +aha,a1 Penyair tampaknyampaknya memper-unakan +aha,a yan- +er+eda den-an +aha,a ,ehari2

memper-unakan +aha,a yan- +er+eda den-an +aha,a ,ehari2 ( Makalah ini di,u,un ,e+a-ai

( Makalah ini di,u,un ,e+a-ai pen--anti Ujian Akhir Seme,ter > dalam mata kuliah Kajian Pui,ipen--anti Ujian Akhir Seme,ter > dalam mata kuliah Kajian Pui,i Indone,ia yan- diampu oleh $r,1 '1

Indone,ia yan- diampu oleh $r,1 '1 Ma?mur Saadie3 M1Pd1 dan %udi Adi !u-roho3 M1 Pd1Ma?mur Saadie3 M1Pd1 dan %udi Adi !u-roho3 M1 Pd1 * Penuli, adalah maha,i,wa Prodi S( Pendidikan Baha,a dan

* Penuli, adalah maha,i,wa Prodi S( Pendidikan Baha,a dan Sa,tra Indone,ia @PBS UPI An-Sa,tra Indone,ia @PBS UPI An-katankatan *;;9 den-an !IM1 ;9;:9;

*;;9 den-an !IM1 ;9;:9;

hari1 'al ini di,e+a+kan +aha,a ,ehari2hari +elum 0ukup

hari1 'al ini di,e+a+kan +aha,a ,ehari2hari +elum 0ukup dapat meluki,kan apa yan- dialami jiwanyadapat meluki,kan apa yan- dialami jiwanya 7Slametmuljan

7Slametmuljana3 (9=)=81 $alam pui,i +elum 0ukup a3 (9=)=81 $alam pui,i +elum 0ukup +ila hanya dikemukakan mak,udnya ,aja3 yan-+ila hanya dikemukakan mak,udnya ,aja3 yan-dikehendaki penyair ialah ,upaya ,iapa yan-

dikehendaki penyair ialah ,upaya ,iapa yan- mem+a0a dapat turut mera,akan dan mem+a0a dapat turut mera,akan dan men-alami ,epertimen-alami ,eperti apa yan- dira,akan dan

apa yan- dira,akan dan dialami penyair1dialami penyair1

Pen--unaan +aha,a ,e,eoran- 7parole8 merupakan penerapan ,i,tem

(2)
(3)

(9::)83 dan pen--unaan +aha,a

(9::)83 dan pen--unaan +aha,a penyair ,ekali-u, penerapan kon4en,i pui,i yan- penyair ,ekali-u, penerapan kon4en,i pui,i yan- ada 7Culler3ada 7Culler3 (9::)((

(9::)((81 !amun penerapan ini tidak 81 !amun penerapan ini tidak ,elalu ,e,uai den-an ,i,tem +aha,a ,elalu ,e,uai den-an ,i,tem +aha,a maupun kon4en,i pui,i yan-maupun kon4en,i pui,i yan-ada ,e+a+ hal

ada ,e+a+ hal ini dipen-aruhi ,itua,i pen--unaan1 Setiap penuli, melak,anakan tandatan-an?nya ,endiriini dipen-aruhi ,itua,i pen--unaan1 Setiap penuli, melak,anakan tandatan-an?nya ,endiri yan- khu,u, dalam 0ara pen--unaan +aha,anya3 yan- mem+edakannya dari karya penuli, lain 7Lod-e3 yan- khu,u, dalam 0ara pen--unaan +aha,anya3 yan- mem+edakannya dari karya penuli, lain 7Lod-e3 (9:)=;81 Maka hal ini ,erin- menye+a+kan

(9:)=;81 Maka hal ini ,erin- menye+a+kan adanya penyimpan-an2penyimpan-an dari ,i,tem normaadanya penyimpan-an2penyimpan-an dari ,i,tem norma +ah,a yan- umum1 $alam pui,i

+ah,a yan- umum1 $alam pui,i penyimpan-an dari ,i,tem tata +ah,a normati5 ,erin- terjadi1 Mak,udnyapenyimpan-an dari ,i,tem tata +ah,a normati5 ,erin- terjadi1 Mak,udnya untuk mendapatkan e5ek puiti,3 untuk mendapatkan ek,pre,i4ita,1

untuk mendapatkan e5ek puiti,3 untuk mendapatkan ek,pre,i4ita,1

Sa,tra merupakan karya 7imajinati58 yan- +ermedium +aha,a3 maka tanda2tanda yan- u

Sa,tra merupakan karya 7imajinati58 yan- +ermedium +aha,a3 maka tanda2tanda yan- utama dalamtama dalam karya ,a,tra itu adalah tanda2tanda ke+aha,aan me,kipun ada kon4en,i ketandaan ,a,tra lain karya ,a,tra itu adalah tanda2tanda ke+aha,aan me,kipun ada kon4en,i ketandaan ,a,tra lain yan-merupakan kon4en,i tam+ahan1 Kon4en,i

merupakan kon4en,i tam+ahan1 Kon4en,i tam+ahan itu diantaranya) perulan-an3 per,ajakan3 tam+ahan itu diantaranya) perulan-an3 per,ajakan3 tipo-ra5i3tipo-ra5i3 pem+a-ian +ari, ,ajak3 pem+aitan3 per,ejajaran3 makna kia,an karena kontek,

pem+a-ian +ari, ,ajak3 pem+aitan3 per,ejajaran3 makna kia,an karena kontek, dalam ,truktur3 yan-dalam ,truktur3 yan-,emuanya itu menim+ulkan makna dalam karya

,emuanya itu menim+ulkan makna dalam karya ,a,tra1,a,tra1

 Adapun latar +elak

 Adapun latar +elakan- penuli, memilian- penuli, memilih ,ajak .Kupu Malh ,ajak .Kupu Malam dan Biniku/ karam dan Biniku/ karena penuli, mera,a tertena penuli, mera,a tertarikarik pada makana yan- terkandun-

pada makana yan- terkandun- dalam ,ajak ini3 terutama dari judulnya1 Kupu malam yan- dalam ,ajak ini3 terutama dari judulnya1 Kupu malam yan- identik den-anidentik den-an wanita tuna ,u,ila yan- di,andin-kan den-an

wanita tuna ,u,ila yan- di,andin-kan den-an kata +ini atau i,tri1 $ari judulnya men--am+arkankata +ini atau i,tri1 $ari judulnya men--am+arkan hu+un-an antara ,eoran- i,tri den-an

hu+un-an antara ,eoran- i,tri den-an penjualan diri ,eoran- wanita atau den-an penjualan diri ,eoran- wanita atau den-an per,elin-kuhanper,elin-kuhan ,eoran- i,tri terhadap ,uami3 layaknya ,ikap wanita tuna

,eoran- i,tri terhadap ,uami3 layaknya ,ikap wanita tuna ,u,ila yan- dapat +erhu+un-an den-an,u,ila yan- dapat +erhu+un-an den-an +e+erapa lelaki yan- +er+eda1

+e+erapa lelaki yan- +er+eda1

Sajak .Kupu Malam dan Biniku/ karya Chairil Anwar men-an-kat tema tentan- kehidupan per0intaan Sajak .Kupu Malam dan Biniku/ karya Chairil Anwar men-an-kat tema tentan- kehidupan per0intaan tokoh aku yan- d

tokoh aku yan- dikhianati oleh i,trinya1 Ke,edihan dan ketidakper0ayaan tokoh aku akan ikhianati oleh i,trinya1 Ke,edihan dan ketidakper0ayaan tokoh aku akan penipuanpenipuan i,trinya3 i,tri yan- ,udah tujuh tahun +er,amanya1 Berikut i,i

i,trinya3 i,tri yan- ,udah tujuh tahun +er,amanya1 Berikut i,i ,ajaknya),ajaknya)

Kupu Malam dan Biniku Kupu Malam dan Biniku

Sam+il +er,eli,ih lalu Sam+il +er,eli,ih lalu men-e+u de+u1 men-e+u de+u1

Kuper0epat lan-kah1 "ak noleh ke Kuper0epat lan-kah1 "ak noleh ke +elakan-!-eri ini luka2ter+uka ,ekali la-i !-eri ini luka2ter+uka ,ekali la-i

terpandan-Barah tern-an-a Barah tern-an-a

Melayan- in-atan ke +iniku Melayan- in-atan ke +iniku Lautan yan- +elum terdu-a Lautan yan- +elum terdu-a

Biar le+ih kami tujuh tahun +er,atu Biar le+ih kami tujuh tahun +er,atu

(4)

Baran-kali tak ,etahuku Baran-kali tak ,etahuku Ia menipuku1

Ia menipuku1 Maret (9<> Maret (9<>

Penelitian ini dilakukan den-an men-a0u pada

Penelitian ini dilakukan den-an men-a0u pada tataran penelitian ,emiotik yan- men0o+a melakukantataran penelitian ,emiotik yan- men0o+a melakukan penelitian terhadap karya ,a,tra 7,ajak8 untuk mendalami makna ,e0ara

penelitian terhadap karya ,a,tra 7,ajak8 untuk mendalami makna ,e0ara penuh1 Berkaitan den-an hal ini3penuh1 Berkaitan den-an hal ini3 teori yan- di-unakan dalam penelitian ini adalah

teori yan- di-unakan dalam penelitian ini adalah teori ,emiotik1teori ,emiotik1 *1 Kajian Pu,taka

*1 Kajian Pu,taka

*1 ( Semiotik Karya Sa,tra *1 ( Semiotik Karya Sa,tra Semiotik +era,al dari +aha,a

Semiotik +era,al dari +aha,a &u&unani3 yaitu ,emeion nani3 yaitu ,emeion yan- +erarti tanda1 Semiotik 7,emiotika8 adalah yan- +erarti tanda1 Semiotik 7,emiotika8 adalah ilmuilmu tentan- tanda2tanda1 Ilmu ini men-an--ap +ahwa 5enomena ,o,ial ma,yarakat d

tentan- tanda2tanda1 Ilmu ini men-an--ap +ahwa 5enomena ,o,ial ma,yarakat dan ke+udayaDan ituan ke+udayaDan itu merupakan tanda2tanda1 Semiotik mempelajari ,i,tem2,i,tem3 aturan2aturan3 dan

merupakan tanda2tanda1 Semiotik mempelajari ,i,tem2,i,tem3 aturan2aturan3 dan kon4en,i2kon4en,ikon4en,i2kon4en,i yan- memunD-kinkan tanda2tanda ter,e+ut

yan- memunD-kinkan tanda2tanda ter,e+ut mempunyai arti1 $alam kritik ,a,tra3 penelitian mempunyai arti1 $alam kritik ,a,tra3 penelitian ,emiotik,emiotik meliputi anali,i, ,a,tra ,e+a-ai ,e+uah pen--unaan +aha,a

meliputi anali,i, ,a,tra ,e+a-ai ,e+uah pen--unaan +aha,a yan- +er-antun- pada 7diDukan8 kon4en,i2yan- +er-antun- pada 7diDukan8 kon4en,i2 kon4en,i tam+ahan dan

kon4en,i tam+ahan dan meneliti 0iri20iri 7,i5at2,i5atmeneliti 0iri20iri 7,i5at2,i5at8 wa0ana yan- 8 wa0ana yan- mempunyai makna 7Pradopo3mempunyai makna 7Pradopo3 *;;=)((981

*;;=)((981

Menurut pandan-an ,emiotik3 ,etiap tanda terdiri dari dua

Menurut pandan-an ,emiotik3 ,etiap tanda terdiri dari dua a,pek3 yaitu penanda 7hal yan- a,pek3 yaitu penanda 7hal yan- menandaimenandai ,e,uatu8 dan petanda 7re5erent yan- dia0u atau dituju oleh tanda tertentu81

,e,uatu8 dan petanda 7re5erent yan- dia0u atau dituju oleh tanda tertentu81 "a

"anda dalam hu+un-an nda dalam hu+un-an den-an a0uannya di+edakan menjadi tanda yanden-an a0uannya di+edakan menjadi tanda yan- dikenal den-an ikon3 indek,3- dikenal den-an ikon3 indek,3 dan ,im+ol1 Ikon adalah tanda yan- antara tanda den-an a0uannya ada hu+un-an

dan ,im+ol1 Ikon adalah tanda yan- antara tanda den-an a0uannya ada hu+un-an kemiripan dan +ia,akemiripan dan +ia,a di,e+ut meta5ora1 Contoh ikon adalah potret1 Bila ada

di,e+ut meta5ora1 Contoh ikon adalah potret1 Bila ada hu+un-an kedekatan ek,i,ten,i3 tanda demikianhu+un-an kedekatan ek,i,ten,i3 tanda demikian di,e+ut indek,1 Contoh indek, adalah tanda panah petunjuk arah +ahwa di ,ekitar tempat itu ada di,e+ut indek,1 Contoh indek, adalah tanda panah petunjuk arah +ahwa di ,ekitar tempat itu ada +an-unan tertentu1 Sim+ol adalah tanda yan- diakui

+an-unan tertentu1 Sim+ol adalah tanda yan- diakui ke+eradaannya +erda,arkan hukum kon4en,i1ke+eradaannya +erda,arkan hukum kon4en,i1 Contoh ,im+ol adalah +aha,a tuli,an1

Contoh ,im+ol adalah +aha,a tuli,an1

Selanjutnya dikatakan Pradopo 7*;;=8 +ahwa dalam penelitian ,a,tra den-an pendeDkatan

Selanjutnya dikatakan Pradopo 7*;;=8 +ahwa dalam penelitian ,a,tra den-an pendeDkatan ,emiotik3,emiotik3 tanda yan- +erupa indek,lah yan-

tanda yan- +erupa indek,lah yan- palin- +anyak di0ari 7di+uru83 yaitu +erupa tanda2tanda yan-palin- +anyak di0ari 7di+uru83 yaitu +erupa tanda2tanda yan-menunjukkan hu+un-an ,e+a+2aki+at 7dalam pen-ertian lua,nya81

menunjukkan hu+un-an ,e+a+2aki+at 7dalam pen-ertian lua,nya81

Semiotik merupakan lanjutan dari penelitian ,trukturali,me1 'u+un-an antara

Semiotik merupakan lanjutan dari penelitian ,trukturali,me1 'u+un-an antara ,emiotik dan ,trukturali,me,emiotik dan ,trukturali,me adalah ,e+a-ai +erikut1

adalah ,e+a-ai +erikut1

/Keteran-an ini akan menjela,kan +a-aimana ,e+enarnya hu+un-an

/Keteran-an ini akan menjela,kan +a-aimana ,e+enarnya hu+un-an antara ,emiotik dan ,trukturali,me1antara ,emiotik dan ,trukturali,me1 7a8 Semiotik di-unakan untuk mem+erikan makna kepada

7a8 Semiotik di-unakan untuk mem+erikan makna kepada tanda2tanda ,e,udah ,uatu penelitiantanda2tanda ,e,udah ,uatu penelitian ,truktural1

,truktural1

7+8 Semiotik hanya dapat dilak,anakan melalui penelitian ,trukturali,me yan- memun-kinkan kita 7+8 Semiotik hanya dapat dilak,anakan melalui penelitian ,trukturali,me yan- memun-kinkan kita menemui tanda2tanda yan- dapat mem+eri makna 7#unu,3

menemui tanda2tanda yan- dapat mem+eri makna 7#unu,3 (9) 981(9) 981 Le+ih lanjut #unu, 7(9) 98

Le+ih lanjut #unu, 7(9) 98 menjela,kan +ahwa pada 7a8 ,emiotik merupakan lanjutan darimenjela,kan +ahwa pada 7a8 ,emiotik merupakan lanjutan dari ,trukturali,me1 Pada 7+8 ,emiotik memerlukan untuk memun-kinkan ia +ekerja1 Pada 7a83 ,emiotik ,trukturali,me1 Pada 7+8 ,emiotik memerlukan untuk memun-kinkan ia +ekerja1 Pada 7a83 ,emiotik ,eakan apendi ?ekor?3

,eakan apendi ?ekor?3 kepada ,trukturali,me1 "akepada ,trukturali,me1 "api tidak demikian pi tidak demikian halnya pada 7+81 halnya pada 7+81 Untuk menemukanUntuk menemukan tanda3 ,e,uai den-an pen-ertian ,e+a-ai ilmu

tanda3 ,e,uai den-an pen-ertian ,e+a-ai ilmu men-enai tanda1 Semiotik tidak dapat memi,ahkan dirimen-enai tanda1 Semiotik tidak dapat memi,ahkan diri dari ,trukturali,me3 ia memerlukan ,trukturali,me 1 dan ,ekali-u,3 ,emiotik ju-a menolon- memahami dari ,trukturali,me3 ia memerlukan ,trukturali,me 1 dan ,ekali-u,3 ,emiotik ju-a menolon- memahami

(5)

,uatu tek, ,e0ara

,uatu tek, ,e0ara ,trukturali,me1/,trukturali,me1/ *1* "ujuan Kajian Semiotik

*1* "ujuan Kajian Semiotik

Inti tujuan ,emiotik adalah memahami makna yan- terdapat da

Inti tujuan ,emiotik adalah memahami makna yan- terdapat dalam ,uatu karya ,a,tra1 Men-anali,i,lam ,uatu karya ,a,tra1 Men-anali,i, ,ajak adalah u,aha untuk menan-kap dan mem+eri makna kepada tek, ,ajak1 Makna ,ajak adalah arti ,ajak adalah u,aha untuk menan-kap dan mem+eri makna kepada tek, ,ajak1 Makna ,ajak adalah arti yan- tim+ul oleh +aha,a yan-

yan- tim+ul oleh +aha,a yan- di,u,un +erda,arkan ,truktur ,a,tra menurut kon4en,inya3 yaitu arti yan-di,u,un +erda,arkan ,truktur ,a,tra menurut kon4en,inya3 yaitu arti yan-+ukan ,emata2mata hanya arti +aha,a3 melainkan +eri,i arti

+ukan ,emata2mata hanya arti +aha,a3 melainkan +eri,i arti tam+ahan +erda,arkan kon4en,i ,a,tra yan-tam+ahan +erda,arkan kon4en,i ,a,tra yan-+er,an-kutan1

+er,an-kutan1 >1 Metode Penelitian >1 Metode Penelitian

Lan-kah men-kaji ,ajak +erda,arkan ,emiotik dalam penelitian ini dimulai den-an

Lan-kah men-kaji ,ajak +erda,arkan ,emiotik dalam penelitian ini dimulai den-an men-anali,i, ,trukturmen-anali,i, ,truktur ,uatu karya ,a,tra1 Kemudian menjadikan un,ur2un,ur itu ,e+a-ai ,im+ol3 ,im+ol2,im+ol ter,e+ut

,uatu karya ,a,tra1 Kemudian menjadikan un,ur2un,ur itu ,e+a-ai ,im+ol3 ,im+ol2,im+ol ter,e+ut dide,krip,ikan +erda,arkan kontek,nya1 Kemudian dilakukan kla,i5ika,i +erda,arkan de,krip,i tadi dan dide,krip,ikan +erda,arkan kontek,nya1 Kemudian dilakukan kla,i5ika,i +erda,arkan de,krip,i tadi dan dita5,irkan maknanya1

dita5,irkan maknanya1

<1 Anali,i, Semiotik Sajak .Kupu Malam dan

<1 Anali,i, Semiotik Sajak .Kupu Malam dan Biniku/Biniku/ Si aku yan- ,em+ari +erjalan ,etelah

Si aku yan- ,em+ari +erjalan ,etelah adanya pertikaian yan- tera,a halu, ,ekali3 memper0epatadanya pertikaian yan- tera,a halu, ,ekali3 memper0epat lan-kahnya tanpa memalin-kan muka ke +elakan-3

lan-kahnya tanpa memalin-kan muka ke +elakan-3 tanpa mempedulikan ,iapapun1 Si aku takut dantanpa mempedulikan ,iapapun1 Si aku takut dan khawatir terhadap luka atau penderitaannya yan- telah

khawatir terhadap luka atau penderitaannya yan- telah ter+uka +ukan untuk pertama kalinya terlihat olehter+uka +ukan untuk pertama kalinya terlihat oleh oran- lain di luar ,ana1

oran- lain di luar ,ana1 Luka dan penderitaannya ,emakin Luka dan penderitaannya ,emakin parah3 +en-kak +ernanah dan ter+uka parah3 +en-kak +ernanah dan ter+uka le+ar3le+ar3 memperlihatkan ra,a ,akit yan- dialami ,i aku

memperlihatkan ra,a ,akit yan- dialami ,i aku +e-itu dalam1 $i perjalanan yan- ,ulit ini3 pikiran ,i +e-itu dalam1 $i perjalanan yan- ,ulit ini3 pikiran ,i akuaku terin-at pada +ini7i,tri8nya3 terin-at akan kelakuan i,trinya yan- +enar2+enar telah menyakiti hati ,i terin-at pada +ini7i,tri8nya3 terin-at akan kelakuan i,trinya yan- +enar2+enar telah menyakiti hati ,i aku1aku1 Si aku tak menyan-ka

Si aku tak menyan-ka +ahwa kehidupan rumah tan--anya +i,a menjadi ,eperti +ahwa kehidupan rumah tan--anya +i,a menjadi ,eperti ini3 i,trinya telah te-aini3 i,trinya telah te-a +e-itu menyakiti hati ,i aku1 Me,kipun mereka

+e-itu menyakiti hati ,i aku1 Me,kipun mereka ,udah +er,ama2,ama menjalin hu+un-an pernikahan,udah +er,ama2,ama menjalin hu+un-an pernikahan ,elama tujuh tahun lamanya1 Mun-kin tak

,elama tujuh tahun lamanya1 Mun-kin tak +anyak yan- diketahui ,i aku +anyak yan- diketahui ,i aku men-enai i,trinya3 +ahwamen-enai i,trinya3 +ahwa ternyata i,trinya telah te-a men-khianati pernikahan mereka1 I,trinya telah te-a menipu ,i

ternyata i,trinya telah te-a men-khianati pernikahan mereka1 I,trinya telah te-a menipu ,i aku1aku1 Sajak ini +erjudul /Kupu Malam dan Biniku/1 Kupu malam

Sajak ini +erjudul /Kupu Malam dan Biniku/1 Kupu malam mak,udnya kupu2kupu malam artinya wanitamak,udnya kupu2kupu malam artinya wanita tuna,u,ila atau pela0ur1 Penyair +ermak,ud men0eritakan tokoh wanita yan- +erkelakuan layaknya tuna,u,ila atau pela0ur1 Penyair +ermak,ud men0eritakan tokoh wanita yan- +erkelakuan layaknya wanita tuna,u,ila1 "

wanita tuna,u,ila1 "okoh wanita yan- dimak,ud penyair adalah tokoh +ini atau okoh wanita yan- dimak,ud penyair adalah tokoh +ini atau i,trinya ,endiri yan- telahi,trinya ,endiri yan- telah men-khianatinya3 +er,elin-kuh atau +erhu+un-an den-an lelaki lain3 dan +ukan

men-khianatinya3 +er,elin-kuh atau +erhu+un-an den-an lelaki lain3 dan +ukan untuk pertama kalinyauntuk pertama kalinya ,,eperti dijela,kan pada +ait kedua +ari,

,,eperti dijela,kan pada +ait kedua +ari, dua /!-eri ini luka2ter+uka ,ekali la-i terpandan-/3 ,ekali la-i3dua /!-eri ini luka2ter+uka ,ekali la-i terpandan-/3 ,ekali la-i3 +erarti +ukan untuk pertama kalinya ,i

+erarti +ukan untuk pertama kalinya ,i i,tri melakukan per+uatan ter0ela ,eperti ini1 'al ini mem+uati,tri melakukan per+uatan ter0ela ,eperti ini1 'al ini mem+uat i,trinya terlihat layaknya ,eoran- wanita tuna ,u,ila di mata

i,trinya terlihat layaknya ,eoran- wanita tuna ,u,ila di mata penyair atau tokoh aku1penyair atau tokoh aku1 "a

"anda2tanda ,emiotik untuk nda2tanda ,emiotik untuk ke,edihan dan keke0ewaan ke,edihan dan keke0ewaan di dalam ,ajak di dalam ,ajak ini ialah kata) +eini ialah kata) +er,eli,ih3r,eli,ih3 n-eri11luka3 111,ekali la-i3 +arah tern-an-a3 lautan yan- +elum terdu-a3 tak ,etahuku3 menipuku1

n-eri11luka3 111,ekali la-i3 +arah tern-an-a3 lautan yan- +elum terdu-a3 tak ,etahuku3 menipuku1 $apat$apat dikatakan3 ini merupakan ,alah ,atu ,ajak Chairil anwar yan-

dikatakan3 ini merupakan ,alah ,atu ,ajak Chairil anwar yan- meman- pada umumnya +er,ua,anameman- pada umumnya +er,ua,ana murun-3 ,uram3 dan ,edih1

murun-3 ,uram3 dan ,edih1

$alam hal +unyi3 yan- dominan dalam ,ajak ini adalah +unyi 4okal u dan a yan-

$alam hal +unyi3 yan- dominan dalam ,ajak ini adalah +unyi 4okal u dan a yan- ,emuanya ini mem+eri,emuanya ini mem+eri ke,an -am+aran ,ua,ana +erat dan ,edih3 ,e,uai den-an ,ua,ana ke,akitan dan penderitaan ke,an -am+aran ,ua,ana +erat dan ,edih3 ,e,uai den-an ,ua,ana ke,akitan dan penderitaan

(6)

yan-meman- di-am+arkan dalam ,ajak ini1 Be-itu ju-a per,ajakan

meman- di-am+arkan dalam ,ajak ini1 Be-itu ju-a per,ajakan atau rima akhir3 ,elain untuk kemerduanatau rima akhir3 ,elain untuk kemerduan

dan kelan0aran ek,pre,i yan- meme+uat liri, ,erta

dan kelan0aran ek,pre,i yan- meme+uat liri, ,erta untuk memeperkera, arti yan- terdapat dalam ,ajakuntuk memeperkera, arti yan- terdapat dalam ,ajak

ini1

ini1

Sam+il +er,eli,ih lalu

Sam+il +er,eli,ih lalu

men-e+u de+u1 men-e+u de+u1 111111111111111111111111 111111111111111111111111 Barah tern-an-a Barah tern-an-a

Melayan- in-atan ke +iniku

Melayan- in-atan ke +iniku

Lautan yan- +elum terdu-a

Lautan yan- +elum terdu-a

Biar le+ih kami tujuh tahun +er,atu

Biar le+ih kami tujuh tahun +er,atu

Baran-kali tak ,etahuku

Baran-kali tak ,etahuku

Ia menipuku1

Ia menipuku1

Untuk ek,pre,i4ita, dan kepadatan3 dalam ,ajak ini

Untuk ek,pre,i4ita, dan kepadatan3 dalam ,ajak ini terdapat penyimapan-an dari tata +aha,a normati5)terdapat penyimapan-an dari tata +aha,a normati5)

Sam+il +er,eli,ih lalu

Sam+il +er,eli,ih lalu

men-e+u de+u1

men-e+u de+u1

Kuper0epat lan-kah1 "ak noleh ke

Kuper0epat lan-kah1 "ak noleh ke

+elakan-!-eri ini luka2ter+uka ,ekali la-i

!-eri ini luka2ter+uka ,ekali la-i

terpandan-Barah tern-an-a

Barah tern-an-a

1111111111111111111111111

1111111111111111111111111

Biar le+ih kami tujuh tahun +er,atu

Biar le+ih kami tujuh tahun +er,atu

hal ini dilakukan ,upaya ek,pre,i4ita,nya tidak hilan- karena

hal ini dilakukan ,upaya ek,pre,i4ita,nya tidak hilan- karena tidak padat dan tidak tidak padat dan tidak +erirama1+erirama1

$alam ,ajak ini diper-unakan +e+erapa 0itraan3 ,eperti 0itra pen-lihatan dan

$alam ,ajak ini diper-unakan +e+erapa 0itraan3 ,eperti 0itra pen-lihatan dan 0itra -erakan1 / Kuper0epat0itra -erakan1 / Kuper0epat

lan-kah1 "a

lan-kah1 "ak noleh ke k noleh ke +elakan-/ ,uatu -erakan di-am+arkan melaui 0itra -erakan3 ,i +elakan-/ ,uatu -erakan di-am+arkan melaui 0itra -erakan3 ,i aku +er-erakaku +er-erak

+erjalan den-an 0epat3 tanpa menoleh ke

+erjalan den-an 0epat3 tanpa menoleh ke +elakan-1 Be-itu ju-a adanya 0itra 4i,ual atau +elakan-1 Be-itu ju-a adanya 0itra 4i,ual atau 0itra0itra

pen-lihatan3 / !-eri ini luka2ter+uka ,ekali la-i terpandan-1 Barah tern-an-a/3 -am+arana luka

pen-lihatan3 / !-eri ini luka2ter+uka ,ekali la-i terpandan-1 Barah tern-an-a/3 -am+arana luka ,i aku,i aku

yan- ,emakin parah3 +arah /+en-kak

yan- ,emakin parah3 +arah /+en-kak +ernanah/3 ,emakin ter+uka le+ar3 ,emakin terlihat luka yan-+ernanah/3 ,emakin ter+uka le+ar3 ,emakin terlihat luka

yan-,edan- di derita oleh tokoh aku1

(7)

$ari uraian di ata, tampak a danya koheren,i yan- kuat dalam ,ajak ini antara un,ur2un,urnya) kia,an3 -aya3 0itraan3 +unyi3 kepdatan3 ek,pre,i4ita,3 per,ajakan dan rima akhir1 Semuanya mem+entuk ,ua,ana ke,akitan dan penderitaan yan- dialami tokoh ,i aku dalam ,ajak /Kupu Malam dan Biniku/ ini1

=1 Simpulan

Berda,arkan pem+aha,an pada +a-ian ,e+elumnya3 dapat di,impulkan +ahwa d alam ,ajak /Kupu Malam dan Biniku/ karya Chairil Anwar ini +eri,i tentan- ki,ah per0intaan tokoh aku yan- -a-al aki+at pen-khianatan i,trinya1 Semua un,ur yan- terdapat dalam ,ajak ini ,e0ara koheren,i mem+entuk -am+aran ,ua,ana ke,akitan dan penderitaan yan- dira,akan oleh tokoh aku1

$a5tar Pu,taka

#unu,3 U1 (91 Karya Se+a-ai Sum+er Makna) Pen-antar Strukturali,me1 Kuala Lumpur) $ewan Baha,a dan Pu,taka1

Pradopo3 $1%1 *;;=1 Be+erapa "eori Sa,tra3 Metode Kritik3 dan Penerpannya1 &o-yakarta) Pu,taka Pelajar1

"eeuw3 A1 (99:1 Citra manu,ia dalam Karya ,a,tra Pramoedya Ananta "oer1 #akarta) Pu,taka #aya1 in5rid !orth1 (99;1 'and+ook o5 Semioti0,1 Bloomin-ton) Indiana Uni4er,ity Pre,,1

Pradopo3 $joko %a0hmat1 *;;91 Pen-kajian Pui,i) Anali,i, Strata !orma dan Anali,i, Struktural dan Semiotik1 &o-yakarta) Gadjah Mada Uni4er,ity Pre,,1

BLOG II

TEORI SEMIOTIK  Sistem Tanda (Semiotik)

Semiotik (semiotic) adalah teori tentang pemberian ‘tanda’. Secara garis besar semiotik  digolongkan menjadi tiga konsep dasar, yaitu semiotik pragmatik (semiotic pragmatic), semiotik  sintatik (semiotic syntactic), dan semiotik semantik (semiotic semantic) (Wikipedia,200).

Semiotik Pragmatik (semiotic pragmatic)

Semiotik !ragmatik menguraikan tentang asal usul tanda, kegunaan tanda oleh yang menerapkannya, dan e"ek tanda bagi yang menginterpretasikan, dalam batas perilaku subyek.

(8)

#alam arsitektur, semiotik prakmatik merupakan tinjauan tentang pengaruh arsitektur (sebagai sistem tanda) terhadap manusia dalam menggunakan bangunan. Semiotik !rakmatik $rsitektur   berpengaruh terhadap indera manusia dan perasaan pribadi (kesinambungan, posisi tubuh, otot

dan persendian). %asil karya arsitektur akan dimaknai sebagai suatu hasil persepsi oleh  pengamatnya, hasil persepsi tersebut kemudian dapat mempengaruhi pengamat sebagai pemakai dalam menggunakan hasil karya arsitektur. #engan kata lain, hasil karya arsitektur merupakan &ujud yang dapat mempengaruhi pemakainya.

Semiotik Sintaktik (semiotic syntactic)

Semiotik Sintaktik menguraikan tentang kombinasi tanda tanpa memperhatikan ‘makna’nya ataupun hubungannya terhadap perilaku subyek. Semiotik Sintaktik ini mengabaikan  pengaruh akibat bagi subyek yang menginterpretasikan. #alam arsitektur, semiotik sintaktik 

merupakan tinjauan tentang per&ujudan arsitektur sebagai paduan dan kombinasi dari berbagai sistem tanda. %asil karya arsitektur akan dapat diuraikan secara komposisional dan ke dalam  bagian'bagiannya, hubungan antar bagian dalam keseluruhan akan dapat diuraikan secara jelas.

Semiotik Semantik (semiotic semantic)

Semiotik Sematik menguraikan tentang pengertian suatu tanda sesuai dengan ‘arti’ yang disampaikan. #alam arsitektur semiotik semantik merupakan tinjauan tentang sistem tanda yang dapat sesuai dengan arti yang disampaikan. %asil karya arsitektur merupakan per&ujudan makna yang ingin disampaikan oleh perancangnya yang disampaikan melalui ekspresi &ujudnya. Wujud tersebut akan dimaknai kembali sebagai suatu hasil persepsi oleh pengamatnya. !er&ujudan makna suatu rancangan dapat dikatakan berhasil jika makna atau ‘arti’ yang ingin disampaikan oleh perancang melalui rancangannya dapat dipahami dan diterima secara tepat oleh  pengamatnya, jika ekspresi yang ingin disampaikan perancangnya sama dengan persepsi  pengamatnya.

TEORI SEMIOTIK 

C.S Peirce

!eirce mengemukakan teori segitiga makna atau triangle meaning yang terdiri dari tiga elemen utama, yakni tanda (sign), object, dan interpretant. anda adalah sesuatu yang berbentuk  "isik yang dapat ditangkap oleh panca indera manusia dan merupakan sesuatu yang merujuk  (merepresentasikan) hal lain di luar tanda itu sendiri. anda menurut !eirce terdiri dari Simbol

(9)

(tanda yang muncul dari kesepakatan), kon (tanda yang muncul dari per&akilan "isik) dan ndeks (tanda yang muncul dari hubungan sebab'akibat). Sedangkan acuan tanda ini disebut objek.*bjek atau acuan tanda adalah konteks sosial yang menjadi re"erensi dari tanda atau sesuatu yang dirujuk tanda.

nterpretant atau pengguna tanda adalah konsep pemikiran dari orang yang menggunakan tanda dan menurunkannya ke suatu makna tertentu atau makna yang ada dalam benak seseorang tentang objek yang dirujuk sebuah tanda.%al yang terpenting dalam proses semiosis adalah  bagaimana makna muncul dari sebuah tanda ketika tanda itu digunakan orang saat  berkomunikasi.

+ontoh Saat seorang gadis mengenakan rok mini, maka gadis itu sedang mengomunikasi mengenai dirinya kepada orang lain yang bisa jadi memaknainya sebagai simbol keseksian. -egitu pula ketika adia Saphira muncul di "ilm +oklat Stro&beri dengan akting dan  penampilan "isiknya yang memikat, para penonton bisa saja memaknainya sebagai icon &anita

muda cantik dan menggairahkan. Ferdinand De Sassre

eori Semiotik ini dikemukakan oleh /erdinand #e Saussure (1'34). #alam teori ini semiotik dibagi menjadi dua bagian (dikotomi) yaitu penanda (signi"ier) dan pertanda (signi"ied). !enanda dilihat sebagai bentuk5&ujud "isik dapat dikenal melalui &ujud karya arsitektur, sedang pertanda dilihat sebagai makna yang terungkap melalui konsep, "ungsi dan5atau nilai'nlai yang terkandung didalam karya arsitektur. 6ksistensi semiotika Saussure adalah relasi antara penanda dan petanda berdasarkan kon7ensi, biasa disebut dengan signi"ikasi. Semiotika signi"ikasi adalah sistem tanda yang mempelajari relasi elemen tanda dalam sebuah sistem berdasarkan aturan atau kon7ensi tertentu. 8esepakatan sosial diperlukan untuk dapat

memaknai tanda tersebut.

9enurut Saussure, tanda terdiri dari -unyi'bunyian dan gambar, disebut signi"ier atau penanda, dan konsep'konsep dari bunyi'bunyian dan gambar, disebut signi"ied.

#alam berkomunikasi, seseorang menggunakan tanda untuk mengirim makna tentang objek dan orang lain akan menginterpretasikan tanda tersebut. *bjek bagi Saussure disebut :re"erent;. %ampir serupa dengan !eirce yang mengistilahkan interpretant untuk signi"ied dan object untuk  signi"ier, bedanya Saussure memaknai :objek; sebagai re"erent dan menyebutkannya sebagai unsur tambahan dalam proses penandaan. +ontoh ketika orang menyebut kata :anjing;

(10)

(signi"ier) dengan nada mengumpat maka hal tersebut merupakan tanda kesialan (signi"ied). -egitulah, menurut Saussure, :Signi"ier dan signi"ied merupakan kesatuan, tak dapat dipisahkan, seperti dua sisi dari sehelai kertas.; (Sobur, 200<).

Ro!and "art#es

eori ini dikemukakan oleh =oland -arthes (3'310), dalam teorinya tersebut -arthes mengembangkan semiotika menjadi 2 tingkatan pertandaan, yaitu tingkat denotasi dan konotasi. #enotasi adalah tingkat pertandaan yang menjelaskan hubungan penanda dan petanda pada realitas, menghasilkan makna eksplisit, langsung, dan pasti. 8onotasi adalah tingkat pertandaan yang menjelaskan hubungan penanda dan petanda yang di dalamnya beroperasi makna yang tidak eksplisit, tidak langsung, dan tidak pasti (>usita 8usumarini,200<).

=oland -arthes adalah penerus pemikiran Saussure. Saussure tertarik pada cara kompleks  pembentukan kalimat dan cara bentuk'bentuk kalimat menentukan makna, tetapi kurang tertarik   pada kenyataan bah&a kalimat yang sama bisa saja menyampaikan makna yang berbeda pada

orang yang berbeda situasinya.

=oland -arthes meneruskan pemikiran tersebut dengan menekankan interaksi antara teks dengan  pengalaman personal dan kultural penggunanya, interaksi antara kon7ensi dalam teks dengan kon7ensi yang dialami dan diharapkan oleh penggunanya. ?agasan -arthes ini dikenal dengan :order o" signi"ication;, mencakup denotasi (makna sebenarnya sesuai kamus) dan konotasi (makna ganda yang lahir dari pengalaman kultural dan personal). #i sinilah titik perbedaan Saussure dan -arthes meskipun -arthes tetap mempergunakan istilah signi"ier'signi"ied yang diusung Saussure.

-arthes juga melihat aspek lain dari penandaan yaitu :mitos; yang menandai suatu masyarakat. :9itos; menurut -arthes terletak pada tingkat kedua penandaan, jadi setelah terbentuk sistem sign'signi"ier'signi"ied, tanda tersebut akan menjadi penanda baru yang kemudian memiliki petanda kedua dan membentuk tanda baru. @adi, ketika suatu tanda yang memiliki makna konotasi kemudian berkembang menjadi makna denotasi, maka makna denotasi tersebut akan menjadi mitos.

9isalnya !ohon beringin yang rindang dan lebat menimbulkan konotasi :keramat; karena dianggap sebagai hunian para makhluk halus. 8onotasi :keramat; ini kemudian berkembang menjadi asumsi umum yang melekat pada simbol pohon beringin, sehingga pohon beringin yang keramat bukan lagi menjadi sebuah konotasi tapi berubah menjadi denotasi pada pemaknaan

(11)

tingkat kedua. !ada tahap ini, :pohon beringin yang keramat; akhirnya dianggap sebagai sebuah 9itos.

"adri!!ard

-audrillard memperkenalkan teori simulasi. #i mana peristi&a yang tampil tidak mempunyai asal'usul yang jelas, tidak merujuk pada realitas yang sudah ada, tidak mempunyai sumber  otoritas yang diketahui. 8onsekuensinya, kata -audrillard, kita hidup dalam apa yang disebutnya hiperrealitas (hyper'reality). Segala sesuatu merupakan tiruan, tepatnya tiruan dari tiruan, dan yang palsu tampaknya lebih n yata dari kenyataannya (Sobur, 200<).

Sebuah iklan menampilkan seorang pria lemah yang kemudian menenggak sebutir pil multi7itamin, seketika pria tersebut memiliki energi yang luar biasa, mampu mengerek sebuah truk, tentu hanya ‘mengada'ada’. 8arena, mana mungkin hanya karena sebutir pil seseorang dapat berubah kuat luar biasa. !adahal iklan tersebut hanya ingin menyampaikan pesan produk  sebagai multi7itamin yang memberi asupan energi tambahan untuk berakti7itas sehari'hari agar  tidak mudah capek. amun, cerita iklan dibuat ‘luar biasa’ agar konsumen percaya. nilah tipuan realitas atau hiperealitas yang merupakan hasil konstruksi pembuat iklan. -arangkali kita masih teringat dengan pengalaman masa kecil (entah sekarang masih ada atau sudah lenyap) di pasar'  pasar tradisional melihat atraksi seorang penjual obat yang memamerkan hiburan sulap kemudian mendemokan khasiat obat di hadapan penontonA !adahal sesungguhnya atraksi tersebut telah ‘direkayasa’ agar terlihat benar'benar manjur di hadapan penonton dan penonton tertarik untuk beramai'ramai membeli obatnya.

$. Derrida

#errida terkenal dengan model semiotika #ekonstruksi'nya. #ekonstruksi, menurut #errida, adalah sebagai alternati" untuk menolak segala keterbatasan pena"siran ataupun bentuk  kesimpulan yang baku. 8onsep #ekonstruksi Byang dimulai dengan konsep demisti"ikasi,  pembongkaran produk pikiran rasional yang percaya kepada kemurnian realitasCpada dasarnya dimaksudkan menghilangkan struktur pemahaman tanda'tanda (sigini"ier) melalui penyusunan konsep (signi"ied). #alam teori ?rammatology, #errida menemukan konsepsi tak pernah membangun arti tanda'tanda secara murni, karena semua tanda senantiasa sudah mengandung artikulasi lain (Subangun, 33D dalam Sobur, 200< 00). #ekonstruksi, pertama sekali, adalah usaha membalik secara terus'menerus hirarki oposisi biner dengan mempertaruhkan bahasa sebagai medannya. #engan demikian, yang semula pusat, "ondasi, prinsip, diplesetkan sehingga

(12)

 berada di pinggir, tidak lagi "ondasi, dan tidak lagi prinsip. Strategi pembalikan ini dijalankan dalam kesementaraan dan ketidakstabilan yang permanen sehingga bisa dilanjutkan tanpa batas.

Sebuah gereja tua dengan arsitektur gothic di depan stiElal bisa mere"leksikan banyak  hal. 8e'gothic'annya bisa mere"leksikan ideologi abad pertengahan yang dikenal sebagai abad kegelapan. Seseorang bisa mena"sirkan bah&a ajaran yang dihantarkan dalam gereja tersebut cenderung ‘sesat’ atau menggiring jemaatnya pada hal'hal yang justru bertentangan dari moral' moral keagamaan yang seharusnya, misalnya mengadakan persembahan'persembahan berbau mistis di altar gereja, dan sebagainya.

 amun, 8e'gothic'an itu juga dapat dita"sirkan sebagai ‘klasik’ yang menandakan kemurnian dan kemuliaan ajarannya. Sesuatu yang klasik biasanya dianggap bernilai tinggi, ‘berpengalaman’, teruji Faman, sehingga lebih dipercaya daripada sesuatu yang si"atnya temporer.#i lain pihak, bentuk gereja yang menjulang langsing ke langit bisa dita"sirkan sebagai ‘"okus ke atas’ yang memiliki nilai spiritual yang amat tinggi. ?ereja tersebut mena&arkan kekhidmatan yang indah yang ‘mempertemukan’ jemaat dan uhan'nya secara khusuk, semata' mata demi uhan. Sebuah persembahan ji&a yang utuh dan istime&a.

#ekonstruksi membuka luas pemaknaan sebuah tanda, sehingga makna'makna dan ideologi baru mengalir tanpa henti dari tanda tersebut. 9unculnya ideologi baru bersi"at menyingkirkan (:menghancurkan; atau mendestruksi) makna sebelumnya, terus'menerus tanpa henti hingga menghasilkan puing'puing makna dan ideologi yang tak terbatas.-erbeda dari -audrillard yang melihat tanda sebagai hasil konstruksi simulati" suatu realitas, #errida lebih melihat tanda sebagai gunungan realitas yang menyembunyikan sejumlah ideologi yang membentuk atau dibentuk oleh makna tertentu. 9akna'makna dan ideologi itu dibongkar melalui teknik dekonstruksi. amun, baik -aurillard maupun #errida sepakat bah&a di balik tanda tersembunyi ideologi yang membentuk makna tanda tersebut.

%m&erto Eco

Stephen W. Gittlejohn (33<) menyebut Hmberto 6co sebagai ahli semiotikan yang menghasilkan salah satu teori mengenai tanda yang paling komprehensi" dan kontemporer. 9enurut Gittlejohn, teori 6co penting karena ia mengintegrasikan teori'teori semiotika sebelumnya dan memba&a semiotika secara lebih mendalam (Sobur, 200<).

6co menganggap tugas ahli semiotika bagaikan menjelajahi hutan, dan ingin memusatkan  perhatian pada modi"ikasi sistem tanda. 6co kemudian mengubah konsep tanda menjadi konsep

(13)

"ungsi tanda. 6co menyimbulkan bah&a :satu tanda bukanlah entitas semiotik yang dapat dita&ar, melainkan suatu tempat pertemuan bagi unsur'unsur independen (yang berasal dari dua sistem berbeda dari dua tingkat yang berbeda yakni ungkapan dan isi, dan bertemu atas dasar  hubungan pengkodean;. 6co menggunakan :kode's; untuk menunjukkan kode yang dipakai sesuai struktur bahasa. anpa kode, tanda'tanda suara atau gra"is tidak memiliki arti apapun, dan dalam pengertian yang paling radikal tidak ber"ungsi secara linguistik. 8ode's bisa bersi"at :denotati"; (bila suatu pernyataan bisa dipahami secara har"iah), atau :konotati"; (bila tampak  kode lain dalam pernyataan yang sama). !enggunaan istilah ini hampir serupa dengan karya Saussure, namun 6co ingin memperkenalkan pemahaman tentang suatu kode's yang lebih  bersi"at dinamis daripada yang ditemukan dalam teori Saussure, di samping itu sangat terkait

dengan teori linguistik masa kini. Ogden ' Ric#ard

eori Semiotika +. 8. *gden dan . $. =ichard merupakan teori semiotika trikotomi yang dikembangkan dari eori Saussure dan eori -arthes yang didalamnya terdapat perkembangan hubungan antara !etanda (signi"ied) dengan !enanda (signi"ier) dimana !enanda kemudian dibagi menjadi dua yaitu !eranti ($ctual /unction5*bject !roperties) dan !enanda (signi"ier) itu sendiri. !etanda merupakan 8onotasi dari !enanda, sedangkan !eranti merupakan #enotasi dari !enanda. !ada teori ini !etanda merupakan makna, konsep, gagasan, sedang !enanda merupakan gambaran yang menjelaskan peranti, penjelasan "isik obyek benda, kondisi obyek5benda, dan cenderung (tetapi tidak selalu) berupa ciri'ciri bentuk, ruang, permukaan dan 7olume yang memiliki suprasegmen tertentu (irama, &arna, tekstur, dsb) dan !eranti merupakan &ujud obyek5benda5"ungsi aktual (+hristian).

Semiotika Teks

!engertian teks secara sederhana adalah :kombinasi tanda'tanda; (!iliang, 2004). #alam  pemahaman yang sama, semua produk desain (termasuk arsitektur dan interior) dapat dianggap sebagai sebuah teks, karena produk desain tersebut merupakan kombinasi elemen tanda'tanda dengan kode dan aturan tertentu, sehingga menghasilkan sebuah ekspresi bermakna dan  ber"ungsi (>usita 8usumarini,200<). #alam menganalisis dengan metode semiotika, pada  prinsipnya dilakukan dalam dua tingkatan analisis, yaitu 

$nalisis tanda secara indi7idual (jenis tanda, mekanisme atau struktur tanda), dan makna tanda secara indi7idual.♣$nalisis tanda sebagai sebuah kelompok atau kombinasi (kumpulan tanda yang membentuk teks), biasa disebut analisis teks.♣Hntuk menganalisis tanda secara indi7idual

(14)

dapat digunakan model analisis tipologi tanda, struktur tanda, dan makna tanda (!iliang, 2004). $nalisis tipologi tanda tersebut menggunakan teori semiotik pengelompokan tanda +harles Sanders !eirce. Sedangkan dalam hal analisis struktur tanda menggunakan teori semiotik  /erdinand de Saussure. 8emudian dalam menganalisis makna tanda dapat dilakukan dengan menggabungkan hasil analisis tipologi tanda dan struktur tanda. ?abungan analisis keduanya (tipologi tanda dan struktur tanda) akan menghasilkan makna tanda yang lebih kuat (>usita 8usumarini,200<).

Hntuk menganalisis tanda secara kelompok atau kombinasinya (analisis teks), tidak hanya sebatas menganalisis tanda (jenis, struktur, dan makna) tetapi juga termasuk pemilihan tanda yang dikombinasi dalam kelompok atau pola yang lebih besar (teks) yang mengandung representasi sikap, ideologi, atau mitos tertentu (latar belakang kombinasi tanda). $da beberapa model dan prinsip analisis teks, salah satunya yang diajukan oleh h&aites (!iliang, 2004). !rinsip dasar analisis teks adalah polisemi (keanekaragaman makna sebuah penanda). 8onotasi tanda berkaitan dengan kode nilai, makna sosial, dan berbagai perasaan, sikap, atau emosi. iap teks adalah kombinasi sintagmatik tanda'tanda yang melalui kode sosial tertentu menghasilkan konotasi tertentu (meta"ora dan metonimi menjadi bagian dari kombinasi tanda). 8onotasi yang  berbeda bergantung pada posisi sosial pembaca dan "aktor lain yang mempengaruhi cara berpikir 

dan mena"sirkan teks. 8onotasi yang diterima luas secara sosial akan menjadi denotasi (makna teks yang dianggap benar). #enotasi merepresentasikan mitos budaya, kepercayaan, dan sikap yang dianggap

"ID* TERP SEMIOTIK 

!ada prinsipnya jumlah bidang terapan semiotika tidaklah terbatas. -idang semiotika ini sendiri bisa berupa proses komunikati" yang tampak lebih alamiah dan spontan hingga pada sistem budaya yang lebih kompleks.3 bidang yang bisa dipertimbangkan sebagai bahan kajian ilmiah Semiotika menurut 6co (333'D), antara lain 

. Semiotika binatang (Foomsemiotic) 2. anda B tanda bauan (ol"actory signs)

4. 8omunikasi rabaan (tactile communication) D. 8ode B kode cecapan (code o" taste)

(15)

. !aralinguistik (paralinguistics)

<. Semiotika medis (medical semiotics)

. 8inesik dan proksemik (kinesics and proIemics) 1. 8ode B kode musik (musical codes)

3. -ahasa B bahasa yang di"ormalkan ("ormaliFed languages)

0. -ahasa tertulis, al"abet tidak dikenal, kode rahasia (&ritten languages, unkno&n alphabets, secret codes)

. -ahasa alam (natural languages)

2. 8omunikasi 7isual (7isual communication) 4. Sistem objek (system o" objects)

D. Struktur alur (plot structure) . eori teks (teIt theory)+

<. 8ode B kode budaya (culture codes) . eks estetik (aesthetic teIts)

1. 8omunikasi 9assa (mass comunication) 3. =etorika (rhetoric)

!ada komunikasi, bidang terapan semiotika pun tidak terbatas. $dapun beberapa contoh aplikasi semiotika di antara sekian banyak pilihan kajian semiotika dalam domain komunikasi antara lain 

. 96#$

9empelajari media adalah adalah mempelajari makna dari mana asalnya, seperti apa, seberapa jauh tujuannya, bagaimanakah ia memasuki materi media, dan bagaimana ia berkaitan

(16)

dengan pemikiran kita sendiri.#alam konteks mediamassa, khusunya media cetak kajian semiotika adalah mengusut ideologi yang melatari pemberitaan.

Hntuk teknik B teknik analisnya sendiri, secara garis besar yang diterapkan adalah  .Teknik kuantitatif 

eknik ini adalah teknik yang paling dapat mengatasi kekurangan dalam objekti7itas, namun hasilnya sering kurang mantap. +iri B ciri yang dapat di ukur dinyatakan sebagai tanda merupakan titik tolak penelitian ini.9enurut Jan Koest, 3334D<'D), hasil analisis kuantitati"  selalu lebih spektakuler namun sekaligus selalu mengorbankan ketahanan uji metode B metode yang digunakan.

2.Teknik kualitatif 

!ada analisis kualitati", data B data yang diteliti tidak dapat diukur secara matematis. $nalisis ini sering menyerang masalah yang berkaitan dengan arti atau arti tambahan dari istilah yang digunakan.

iga pendekatan untuk menjelaskan media (9cair, 33D, dalam Sudibyo, 2002'D) +. Pendekatan Po!itik,Ekonomi

!endekatan ini berpendapat bah&a isi media lebih ditentukan oleh kekuatan B kekuatan ekonomi dan politik di luar pengelolaan media.

-. Pendekatan Organisasi

-ertolak belakang dengan pendekatan politik'ekonomi, pendekatan ini menekankan  bah&a isi media diasumsikan dipengaruhi oleh kekuatan B kekuatan eksternal di luar diri  pengelola media.

. Pendekatan K!tra!is

9erupakan pendekatan politik'ekonomi dan pendekatan organisasi. !roses produksi  berita dilihat sebagai mekanisme yang rumit yang melibatkan "aktor internal media. 9edia pada

dasarnya memang mempunyai mekanisme untuk menentukan pola dan aturan oragnisasi, tapi  berbagai pola yang dipakai untuk memaknai peristi&a tersebut tidak dapat dilepaskan dari

(17)

kekuatan B kekuatan politik'ekonomi di luar media.Secara teoritis, media massa bertujuan menyampaikan in"ormasi dengan benar secara e"ekti" dan e"isien. amun, pada praktiknya apa yang disebut sebagai kebenaran ini sangat ditentukan oleh jalinan banyak kepentingan.

erdapat pemilahan atas "akta atau in"ormasi yang dianggap penting dan yang dianggap tidak penting, serta yang dianggap penting namun demi kepentingan sur7i7al menjadi tidak perlu disebar luaskan. 9edia menyunting bahkan menggunting realitas dan kemudian memolesnya menjadi suatu kemasan yang layak disebar luaskan.

iga Fona dalam teori media menurut Berger dan Luckman 

. *rders and practices o" signi"ication L atanan dan praktik B praktik signi"ikasi. 2. *rders and practises o" po&er L atanan dan praktik B praktik kekuasaan.

4. *rders and practises o" production L atanan dan praktik B praktik produksi.

!raktik B praktik kekuasaan media memiliki banyak bentuk ( @ohn -. homson, 33D) antara lain

•8ekuasaan 6konomi CC dilembagakan dalam industri dan perdagangan. •8ekuasaan !olitik CCC dilembagakan dalam aparatur negara

•8ekuasaan 8oersi" CCB dilembagakan dalam organisasi militer dan paramiliter. -. Perik!anan

#alam perspekti" semiotika iklan dikaji le&at sistem tanda dalam iklan, yang terdiri atas 2 lambang yakni lambang 7erbal (bahasa) dan lambang non 7erbal (bentuk dan &arna yang disajikan dalam iklan).#alam menganalisis iklan, beberapa hal yang perlu diperhatikan antara lain (-erger) 

•!enanda dan petanda •?ambar, indeks, simbol •/enomena sosiologi

(18)

•Si"at daya tarik yang dibuat untuk menjual produk  •#esain dari iklan

•!ublikasi yang ditemukan dalam iklan dan khayalan yang diharapkan oleh publikasi tersebut.

Gain halnya dengan model =oland -arthes, iklan dianalisis berdasarkan pesan yang dikandungnya yaitu 

o!esan Ginguistik CCCCCCCCB Semua kata dan kalimat dalam iklan

o!esan yang terkodekan CCCCCC 8onotasi yang muncul dalam "oto iklan

o!esan ikonik yang tak terkodekan CB #enotasi dalam "oto iklan . Tanda on/er&a!

8omunikasi non7erbal adalah semua tanda yang bukan kata B kata dan bahasa. anda B tanda digolongkan dalam berbagai cara 

•anda yang ditimbulkan oleh alam yang kemudian diketahui manusia melalui  pengalamannya.

•anda yang ditimbulkan oleh binatang

•anda yang ditimbulkan oleh manusia, bersi"at 7erbal dan non7erbal.

 amun tidak keseluruhan tanda B tanda non7erbal memiliki makna yang uni7ersal. %al ini dikarenakan tanda B tanda non7erbal memiliki arti yang berbeda bagi setiap budaya yang lain.#alam hal pengaplikasian semiotika pada tanda non7erbal, yang penting untuk diperhatikan adalah pemahaman tentang bidang non7erbal yang berkaitan dengan benda konkret, nyata, dan dapat dibuktikan melalui indera manusia.

!ada dasarnya, aplikasi atau penerapan semiotika pada tanda non7erbal bertujuan untuk  mencari dan menemukan makna yang terdapat pada benda B benda atau sesuatu yang bersi"at non7erbal. #alam pencarian makna tersebut, menurut -udianto, ada beberapa hal atau beberapa langkah yang perlu diperhatikan peneliti, antara lain 

(19)

•Gangkah !ertama CC' 9elakukan sur7ai lapangan untuk mencari dan menemukan objek   penelitian yang sesuai dengan keinginan si peneliti.

•Gangkah 8edua CCC' 9elakukan pertimbangan terminologis terhadap konsep Bkonsep  pada tanda non7erbal.

•Gangkah 8etiga CCC' 9emperhatikan perilaku non7erbal, tanda dan komunikasi terhadap objek yang ditelitinya.

•Gangkah 8eempat CB 9erupakan langkah terpenting CB menentukan model semiotika yang dipilih untuk digunakan dalam penelitian. ujuan digunakannya model tertentu adalah pembenaran secara metodologis agar keabsahan atau objekti7itas penelitian tersebut dapat terjaga.

0. Fi!m

/ilm merupakan bidang kajian yang amat rele7an bagi analisis struktural atau semiotika.

/an 1oest CB "ilm dibangun dengan tanda semata B mata. !ada "ilm digunakan tanda B  tanda ikonis, yakni tanda B tanda yang menggambarkan sesuatu. ?ambar yang dinamis dalam "ilm merupakan ikonis bagi realitas yang dinotasikannya./ilm umumnya dibangun dengan  banyak tanda. >ang paling penting dalam "ilm adalah gambar and suara. /ilm menuturkan ceritanya dengan cara khususnya sendiri yakni, mediumnya, cara pembuatannya dengan kamera dan pertunjukannya dengan proyektor dan layar.

Sardar ' 2oon CCB /ilm dan tele7isi memiliki bahasanya sendiri dengan sintaksis dan tata bahasa yang berbeda. /ilm pada dasarnya bisa melibatkan bentuk B bentuk simbol 7isual dan linguistik untuk mengkodekan pesan yang sedang disampaikan./igur utama dalam  pemikiran semiotika sinematogra"i hingga sekarang adalah +hristian 9etF dari 6cole des %autes

6tudes et Sciences Sociales (6%6SS) !aris. 9enurutnya, penanda (signi"ant) sinematogra"is memiliki hubungan moti7asi atau beralasan dengan penanda yang tampak jelas melalui hubungan penanda dengan alam yang dirujuk. !enanda sinematogra"is selalu kurang lebih  beralasan dan tidak pernah semena.

3. Komik Kartn Karikatr

Sebelum memasuki pembahasan, terlebih dahulu kita ketahui apa yang dimaksud dengan komik, kartun, serta karikatur.8omik adalah cerita bergambar dalam majalah,surat kabar, atau

(20)

 berbentuk buku yang pada umumnya mudah dicerna dan lucu. 8omik sendiri dikelompokkan menjadi dua jenis yaitu, comic strips dan comic book. 8omik bertujuan utama menghibur   pembaca dengan bacaan ringan, cerita rekaan yang dilukiskan relati" panjang dan tidak  selamanya mengangkat masalah hangat meskipun menyampaikan moral tertentu. -ahasa komik  adalah bahasa gambar dan bahasa teks.

8artun adalah sebuah gambar lelucon yang muncul di media massa, yang hanya berisikan humor semata, tanpa memba&a beban kritik sosial apapun. !ada dasarnya, kartun mengungkapkan masalah sesaat secara ringkas namun tajam dan humoristis sehingga tidak   jarang membuat pembaca senyum sendirian.

8arikatur adalah de"ormasi berlebihan atas &ajah seseorang, biasanya orang terkenal, dengan mempercantiknya dengan penggambaran ciri khas lahiriyahnya untuk tujuan mengejek  (Sudarta,31). 6mpat teknis yang harus diingat sebagai karikatur adalah, harus in"ormati" dan komunikati", harus situasional dengan pengungkapan yang hangat, cukup memuat kandungan humor, harus mempunyai gambar yang baik. Semula karikatur hanya merupakan selingan atau ilustrasi belaka. amun pada perkembangannya, karikatur dijadikan sarana untuk menyampaikan kritik yang sehat karena penyampaiannya dilakukan dengan gambar B gambar lucu dan menarik   bahkan tidak jarang membuat orang yang dikritik justru tersenyum.

Tommy C#ristomy CCC Secara "ormal proses semiosis yang paling dominan dalam kartun adalah gabungan atau proposisi (7isual dan 7erbal) yang dibentuk oleh kombinasi tanda argumen indeIical legisign.Hntuk menganalisis kartun atau komik'kartun, seyogyanya kita menempatkan diri sebagai kritikus agar secara leluasa dapat melakukan penilaian dan memberi ta"siran terhadap komik'kartun tersebut.

Setia4an CC 8omik'kartun penuh dengan perlambangan B perlambangan yang kaya akan makna. Selain dikaji sebagai teks, secara kontekstual juga dilakukan yakni dengan menghubungkan karya seni tersebut dengan situasi yang sedang menonjol di masyarakat. #alam  pandangan Setia&an hal ini di maksudkan untuk menjaga signi"ikasi permasalahan dan sekaligus

menghindari pembiasan ta"siran 5. Sastra

Santosa CC #alam lapangan sastra, karya sastra dengan keutuhannya secara semiotik  dapat dipandang sebagai sebuah tanda. Sebagai suatu bentuk, karya sastra secara tulis akan

(21)

memiliki si"at kerungan. #imensi ruang dan &aktu dalam sebuah cerita rekaan mengandung tabiat tanda'menanda yang menyiratkan makna semiotika.

mindin CC Wa&asan semiotika dalam studi sastra memiliki tiga asumsi 

•8arya sastra merupakan gejala komunikasi yang berkaitan dengan pengarang, &ujud sastra sebagai sistem tanda, dan pembaca.

•8arya sastra merupakan salah satu bentuk pengunaan sistem tanda (system o" signs) yang memiliki struktur dalam tata tingkat tertentu.

•8arya sastra merupakan "akta yang harus direkonstruksikan pembaca sejalan dengan dunia  pengalaman dan pengetahuan yang dimilikinya.

Sasaran kajian sastra secara ilmiah bukan pada &ujud konkret &acananya, melainkan pada metadiscourse atau bentuk dan ciri ke&acanaan yang tidak teramati secara konkret

$ns CBPradopo C' !enelitian sastra dengan pendekatan semiotika sesungguhnya merupakan lanjutan dari pendekatan strukturalisme. Strukturalisme tidak dapat dipisahkan dengan semiotika karena karya sastra merupakan struktur tanda B tanda yang bermakna. anpa memperhatikan sistem tanda dan maknanya, serta kon7ensi tanda, struktur karya sastra atau karya sastra tidak dapat dimengerti secara optimal.#alam penelitian sastra dengan menggunakan  pendekatan semiotika, tanda yang berupa indekslah yang paling banyak dicari, yaitu berupa

tanda B tanda yang menunjukkan hubungan sebab'akibat.

Preminger  CC' Studi semiotika sastra adalah usaha untuk menganalisis sistem tanda B  tanda. *leh karena itu, peneliti harus menentukan kon7ensi B kon7ensi apa yang memungkinkan karya sastra mempunyai makna.

6. Msik 

Sistem tanda musik adalah oditi". -agi semiotikus musik, adanya tanda B tanda perantara, yakni, musik yang dicatat dalam partitur orkestra, merupakan jalan keluar. %al ini sangat memudahkan dalam menganalisis karya musik sebagai teks. tulah sebabnya mengapa penelitian musik semula terutama terarah pada sintaksis. 9eski demikian, semiotika tidak dapat hidup hanya dengan mengandalkan sintaksis karena tidak ada semiotika tanpa semantik juga tidak ada semiotika musik tanpa semantik musik.

(22)

art 7an 1oest CB iga kemungkinan dalam mencari denotatum musik ke arah isi tanggapan dan perasaan 

•Hntuk menganggap unsur B unsur struktur musik sebagai ikonis bagi gejala B gejala neuro"isiologis pendengar,

•Hntuk menganggap gejala B gejala struktural dalam musik sebagai ikonis bagi gejala B  gejala struktural dunia penghayatan yang dikenal.

•Hntuk mencari denotatum musik ke arah isi tanggapan dan perasaan yang dimunculkan musik le&at indeksial.

Hntuk menganalisi musik tentu juga diperlukan disiplin lain, misalnya ethnomusicology dan antropologi. #alam ethnomusicology, musik dipelajari melalui aturan tertentu yang dihubungkan dengan bentuk kesenian lainnya termasuk bahasa, agama, dan "alsa"ah.

Diposkan oleh o_N_o di09.45 15 KOME NTAR:

1.

arpegio5 September 2009 05.36

 bung jun,sy lg tertatik mempelajari semiotika musik,,&alaupun agak bingung2 jg seeh..bkin postingan khuhus ttg semiotika musik dong..mkasih

Balas

2.

ami_icas_jkt29 Desember 2010 07.50

aku copy artikel ni buat bhn tmbhn ya..thI..tp ko re""ensiny ga trcantum ya...

Balas

(23)

Mari Cita Ba!asa "ita12 #$i 2011 23.%0

&o& artikelnya mantappp surantap...

kebetulan aku lagi ada tugas dari asdosku..

 bt&, aku punya tugas tentang analisis naskah drama dengan teori semiotika ini. jelaskan dong cara kerjanya atau contoh yang berkaitan dengan penerapan teori semiotika

terhadap karya sastra...ok  

oh ya...artikel semiotik ri""aternya juga dong diposting..ok.. trimFF

Balas BLOG III

PENGENALAN PENDEKATAN STRUKTUR SEMIOTIKA

BAB I

PENDAHULUAN

A.LatarBelakang

Perkembangansastrasekaranginisangatpesatdankeluardarikaidah-kaidahpenulisanyangada. Banyakhal-halbaruyangmunculdantidaksesuaidengankonvensi-konvensi.Olehkarenaitu dalam makalahiniakandibahasmengenaipendekatansemiotikdalam analisispuisi.

Studisastrabersifatsemiotikmerupakanusahauntukmenganalisiskaryasastra,disinisajak khususnya,sebagaisuatusistem tanda-tandadanmenentukankonvensi-konvensiapayang memungkinkankaryasastramempunyaimakna.Denganmelihatvariasi-variasididalam struktur sajakatauhubungandalam (internal)antaraunsur-unsurnyaakandihasilkanbermacam-macam makna. SemiotiksepertiyangdiungkapkanolehRachmatDjokoPradopoyaitubahwabahasasebagai medium karyasastrasudahmerupakansistem semiotikatauketandaan,yaitusistem ketandaan yangmempunyaiarti.Medium karyasastrabukanlahbahanyangbebas(netral)sepertibunyipada senimusikataupunwarnapadalukisan.Warnacatsebelum digunakandalam lukisanmasihbersifat netral,belum mempunyaiartiapa-apasedangkankata-kata(bahasa)sebelum dipergunakandalam karyasastrasudahmerupakanlambangyangmempunyaiartiyangditentukanolehperjanjian masyarakat(bahasa)atauditentukanolehkonvensi-konvensimasyarakat.Lambang-lambangatau tanda-tandakebahasaanituberupasatuan-satuanbunyiyangmempunyaiartiolehkonvensi masyarakat.Bahasaitumerupakansistem ketandaanyangberdasarkanatauditentukanoleh konvensi(perjanjian)masyarakat.Sistem ketandaanitudisebutdengansemiotik.Begitupulailmu yangmempelajarisistem tanda-tandaitudisebutsemiotika(2009:121).

(24)

B.Tujuan

Tujuandaripenulisanmakalahiniyaituuntukmemahamipendekatanstruktursemiotikdalam analisispuisidanaplikasinya.

C. Rumusan Masalah

Rumusan masalah dalam makalah ini adalah:

1. Apa yang dimaksud dengan semiotik?

2.Bagaimanauntukmemahamianalisissemiotik?

3.Siapakahtokohdalam teorisemiotik?

BAB II

PEMBAHASAN

A.PengertianSemiotik

Semiotik(semiotics)berasaldaribahasaYunani“semeion”yangberartitandaatausign.Tanda tersebutmenyampaikansuatuinformasisehinggabersifatkomunikatif,mampumenggantikansuatu yanglain(standforsomethingelse)yangdapatdipikirkanataudibayangkan(Broadbent,1980).

A.Teew (1984:6)mendefinisikansemiotikadalahtandasebagaitindakkomunikasidankemudian disempurnakan menjadi model sastra yang mempertanggungjawabkan semua faktor dan aspek hakikiuntukpemahamangejalasusastrasebagaialatkomunikasiyangkhasdidalam masyarakat mana pun. Menurut Pradopo (2005: 121), semiotik merupakan sistem ketandaan yang berdasarkan atauditentukanolehkonvensi(perjanjianmasyarakat).Lambang-lambangatautanda-tanda

kebahasaanituberupasatuan-satuanbunyiyangmempunyaiartikonvensionalmasyarakat.Teori semiotiktidakterlepasdarikode-kodeuntukmembermaknaterhadaptandayangadadalam karya sastra.Kode-kodemerupakanobjeksemiotiksebabkode-kodeitumerupakansistem-sistem yang mengatasi dan menguasai pengirim dan penerima tanda atau manusia pada umumnya (Pradopo, 1995:26).

Teorisemiotikmemperhatikansegalafaktoryangikutmemainkanperanandalam komunikasi, sepertifaktorpengirim tanda,penerimaantanda,danstrukturtandaitusendiri.Berdasarkan

penjelasandiatasdiketahuikaryasastraitumerupakanstrukturbermakna.Halinimengingatbahwa karya sastra merupakan sistem tanda yang mempunyai makna yang mempunyai makna yang

mempergunakan medium bahasa. Dalam usaha menangkap, memberi, dan memahami makna yang terkandungdidalam karyasastra,pembacalahyangsangatberperan.Karyasastratidakakan

(25)

B.AnalisisSemiotik

Menganalisissajakitubertujuanmemahamimaknasajak.Menganalisissajakadalahusaha menangkap dan memberi makna kepada teks sajak. Karya sastra itu merupakan struktur yang bermakna.Halinimengingatbahwakaryasastraitumerupakansistem tandayangmempunyai makna yang mempergunakan medium bahasa.

Bahasasebagaimedium karyasastrasudahmerupakansistem semiotikatauketandaan,yaitu sistem ketandaanyangmempunyaiarti.Medium karyasastrabukanlahbahanyangbebas(netral) sepertibunyipadasenimusikataupunwarnapadalukisan.Warnacatsebelum digunakandalam lukisanmasihbersifatnetral,belum mempunyaiartiapa-apa,sedangkankata-kata(bahasa) sebelum dipergunakan dalam karya sastra sudah merupakan lambang yang mempunyai arti yang ditentukanolehperjanjianmasyarakat(bahasa)atauditentukanolehkonvensimasyarakat.

Lambang-lambang atau tanda-tanda kebahasaan itu berupa satuan-satuan bunyi yang mempunyai artiolehkonvensimasyarakat.Bahasaitumerupakansistem ketandaanyangberdasarkanatau ditentukanolehkonvensi(perjanjian)masyarakat.Sistem ketandaanitudisebutsemiotikatau semiologi.

C.TeoriSemiotik

Teorisemiotikdipaparkanolehduatokohyanghidupsezaman,namunmerekatidakpernah

bertemu,bekerjasecaraterpisahyakniseorangahlilinguistikyaituFerdinandDeSaussure( 1857-1913)danseorangahlifilsafatbermadhabAngloAmerikayangbernamaCharlesSanderPeirce (1839-1913).SaussuremenyebutilmutersebutdenganistilahsemiologidanPeircemenyebutnya semiotik.

1. Ferdinand De Saussure

TeoriSemiotikinidikemukakanolehFerdinandDeSaussure(1857-1913).Dalam teoriinisemiotik dibagimenjadiduabagian(dikotomi)yaitupenanda(signifier)danpertanda(signified).Penanda dilihatsebagaibentuk/wujudfisikdapatdikenalmelaluiwujudkaryaarsitektur,sedangpertanda dilihatsebagaimaknayangterungkapmelaluikonsep,fungsidan/ataunilai-nilaiyangterkandung didalam karyaarsitektur.EksistensisemiotikaSaussureadalahrelasiantarapenandadanpetanda berdasarkankonvensi,biasadisebutdengansignifikasi.Semiotikasignifikasiadalahsistem tanda yangmempelajarirelasielementandadalam sebuahsistem berdasarkanaturanataukonvensi tertentu.Kesepakatansosialdiperlukanuntukdapatmemaknaitandatersebut.

MenurutSaussure,tandaterdiridari:Bunyi-bunyiandangambar,disebutsignifierataupenanda,dan konsep-konsepdaribunyi-bunyiandangambar,disebutsignified.Dalam berkomunikasi,seseorang menggunakantandauntukmengirim maknatentangobjekdanoranglainakanmenginterpretasikan tandatersebut.ObjekbagiSaussuredisebut“referent”.HampirserupadenganPeirceyang

mengistilahkaninterpretantuntuksignifieddanobjectuntuksignifier,bedanyaSaussurememaknai “objek”sebagaireferentdanmenyebutkannyasebagaiunsurtambahandalam prosespenandaan.

(26)

Contoh:ketikaorangmenyebutkata“anjing”(signifier)dengannadamengumpatmakahaltersebut merupakantandakesialan(signified).Begitulah,menurutSaussure,“Signifierdansignified

merupakankesatuan,takdapatdipisahkan,sepertiduasisidarisehelaikertas.”(Sobur,2006).

2.CharlesSanderPeirce

Peircemengemukakanteorisegitigamaknaatautrianglemeaningyangterdiridaritigaelemen utama,yaknitanda(sign),object,daninterpretant.Tandaadalahsesuatuyangberbentukfisikyang dapat ditangkap oleh panca indera manusia dan merupakan sesuatu yang merujuk

(merepresentasikan)hallaindiluartandaitusendirisedangkanacuantandainidisebutobjek.Objek atauacuantandaadalahkontekssosialyangmenjadireferensidaritandaatausesuatuyangdirujuk tanda.

Interpretantataupenggunatandaadalahkonseppemikirandariorangyangmenggunakantanda dan menurunkannya ke suatu makna tertentu atau makna yang ada dalam benak seseorang tentang objekyangdirujuksebuahtanda.Halyangterpentingdalam prosessemiosisadalahbagaimana maknamunculdarisebuahtandaketikatandaitudigunakanorangsaatberkomunikasi.

Contoh: Saat seorang gadis mengenakan rok mini, maka gadis itu sedang mengkomunikasi

mengenaidirinyakepadaoranglainyangbisajadimemaknainyasebagaisimbolkeseksian.Begitu pulaketikaNadiaSaphiramunculdifilm CoklatStrowberidenganaktingdanpenampilanfisiknya yangmemikat,parapenontonbisasajamemaknainyasebagaiiconwanitamudacantikdan menggairahkan.

TandamenurutPeirceterdiridariSimbol(tandayangmunculdarikesepakatan),Ikon(tandayang munculdariperwakilanfisik)danIndeks(tandayangmunculdarihubungansebab-akibat).

·Ikon

Ikon(iconicsign)adalahsegalasesuatuyangdapatdikaitkandengansesuatuyanglain. Hubungannya terletak pada persamaan atau kemiripan. Tanda ikonik dapat mengungkapkan sesuatukarenaantarapenandadanpetandamemilikikeserupaanataukemiripanwujudataupun kualitas-kualitastertentu.Ikonadalahungkapan‘tanda’suatuobjekberdasarkanpersepsiimajinatif yangmengaitkanobjektersebutdenganobjeklainyangbelum tentuada.Contohnyaadalahfoto, yangmewakiligambaraslinya,miniaturataupatungyangmiripdenganyangaslinya.Karena terdapatkesamaandiantarapenandadanpetanda,makaikonadalahqualisign(kualitastanda), makaprosessemiotisinidinamakanolehPeircedenganfirstness.

Zoestmenguraiikondalam tigamacam perwujudan:1)ikonspasialatautopologis,yangditandai denganadanyakemiripanantararuangatauprofildanbentukteksdenganapayangdiacunya;2) ikonrelasionalataudiagramatik,dimanaterjadikemiripanantarahubunganduaunsurtekstual denganhubunganduaunsuracuan;dan3)ikonmetafora,disinibukanlagidilihatadanyakemiripan

(27)

antara tanda dan acuan, namun antara dua acuan, artinya dua acuan dengan tanda yang sama (Dahana,2001:22;Sobur,2004:158).

· Simbol

Simbol(symbolicsign)menekankanpadakesepakatan,kebiasaanataukonvensimasyarakatyang melandasihubunganarbitrerantarapenandadanpetanda.Karenatandasimbolissepenuhnya didasarkan pada kesepakatan masyarakat, maka masyarakat dalam lingkup yang berbeda sangat mungkin memahami tanda dengan makna yang berbeda.

Simboladalahungkapan‘tanda’suatuobjekberdasarkankonseptertentu,biasanyaasosiasi terhadapsuatugagasanumum.Sebagaicontoh,tuguMonastidakterdapatrelasiyangserupa ataupunlogisdengankotaJakarta,namuntuguinidijadikansimbolkotaJakarta.Ataucontohlain misalnyamenganggukyangberartisetujuataumengiyakan,menggelengberartitidak,tidakterdapat hubunganapapundenganartiyangdimaksud.Kesemuanyaituberdasarkankesepakatan.Peirce mengungkapkan(Sobur,2004:159),istilahsimbolsehari-harilazim disebutkata(word),nama (name),danlabel(label).

·Indeks

Indeks(indexicalsign)menunjukanpadasesuatu,bukanberdasarkanpadakemiripantetapilebih menekankanpadaketerkaitanlogisnyaatauhubungankausalitasnya(sebab-akibat).Indeksadalah ungkapan‘tanda’ataurepresentasisuatuobjekakibathubungandinamisantaraobjekyangditerima secara fisik dan mempengaruhi perasaan atau ingatan seseorang dalam pembentukan persepsinya. Contohnyaasapmenunjukkanadanyaapi.Indeksadalahtandayangsifatnyatergantungdari

keberadaannyasuatudenotasi,sehinggadalam terminologiPeircemerupakansuatusecondness.

Bahasa yang merupakan sistem tanda yang kemudian dalam karya sastra menjadi mediumnya itu adalahsistem tandatingkatpertama.Dalam ilmutanda-tandaatausemiotik,artibahasasebagai sistem tandatingkatpertamaitudisebutmeaning(arti).Karyasastraitujugameupakansistem tandayangberdasarkankonvensimasyarakat(sastra).Karenasastra(karyasastra)merupakan sistem tandayanglebihtinggi(atas)kedudukannyadaribahasa,makadisebutsistem semiotik tingkatkedua.

Meskipunsastraitudalam sistem semiotiktingkatannyalebihtinggidaripadabahasa,namunsastra tidakdapatlepaspuladarisistem bahasa.Halinidisebabkanolehapayangtelahdikemukakan, yaitubahasaitusudahmerupakansistem tandayangmempunyaiartiberdasarkankonvensi tertentu.

BABIII

(28)

A.Kesimpulan

Semiotikadalahilmuyangmempelajarisecarasistematiktanda-tandadanlambang-lambang

Tokohdalam aliransemiotikyaituFerdinandDeSaussureyangmembagisemiotikmenjadi2bagian yaitupenandadanpetanda.SedangkanmenurutCharlesSanderPeircetandaterbagimenjadi3 yaitusimbol,ikon,danindeks.

Simbol à hubungan tanda dengan objek karena ada kesepakatan.

Indeks à hubungan tanda dengan objek karena ada hubungan sebab-akibat. Ikon à hubungan tanda dengan objek karena serupa.

Sumber:anniunni.blogspot.com/2012/08/pendekatan-struktural-semiotik SEMIOTIK SASTRA

Semiotikadalahteoritentangtanda,adapulayangmengatakanbahwainiadalahteoritentanggaya bahasa.A.Teew (1984:6)mendefinisikansemiotikadalahtandasebagaitindakankomunikasidan kemudian disempurnakan menjadi model sastra yang mempertanggungjawabkan semua faktor dan aspekhakiki,untukpemahamangejalasusastrasebagaialatkomunikasiyangkhasdalam

masyarakat.

Semiotikmerupakanbahasayangmencerminkanbahasasastrayangestetis,sistematisdan memilikipluralitasmaknaketikadibacaolehpembacadalam memberipemahamanterhadapteks karyasastra.

Semiotikterbagiatastigakonsep,yaitu:

Semiotikpragmatik,berkaitandenganasal-usultanda,kegunaantandadalam penerapan,danefek tandabagiyangmenginterpretasikannya.Semiotikpragmatikinidalam batasperilakuobjek.

Semiotiksintaktik,adalahkombinasitandatanpamemperhatikanmaknanyaataupunhubungannya terhadapperilakusubjek.

Semiotiksemantik,adalahtandadalam "arti"yangdisampaikan. Wawasansemiotikdalam studisastra(Amminudin):

Karyasastramerupakangejalakonsumsiyangberkaitandenganpengarang,wujudsastrasebagai sistem tanda, dan pembaca.

Karyasastramerupakansalahsatubentukpenggunaansistem tandayangmemilikistrukturdalam tatatingkattertentu.

(29)

Karyasastramerupakanfaktayangharusdirekrontruksikanpembacasejalandengandunia pengalamandanpengetahuanyangdimilikinya.

Teorisemiotik

CharlesSanderPierce(1839-1913),mengemukakantentangteorisegitigamakna: Tanda(sign),adalahsesuatuyangberbentukfisikyangdapatditangkapolehpancaindera

manusiadanmeripakansesuatuyangmerujuk(merepresentasi)hallaindiluartandaitusendiri. Tandaterbagimenjaditigayaitusimbol,ikon,danindeks.Simboladalahtandayangmunculdari kesepakatanataukonvensi-konvensibahasa.Ikonadalahtanda-tandayangmunculdari perwakilanfisik.Indeksadalahtandayangmunculdarihubungansebabakibat.Dalam penelitian sastradenganmenggunakanpendekatansemiotik,tandaberupaindeksyangpalingbanyakdicari, yaituberupatanda-tandayangmenunjukanhubungansebab-akibat.

Interpretantataupenggunaantanda,adalahkonseppemikirandariorangyangmenggunakantanda dan menurunkannya ke suatu makna tertentu atau makna yang ada dalam benak seseorang tentang objekyangdirujuksebuahtanda.

Objek,adalahkontekssosialyangmenjdireferensidaritandaatausesuatuyangdirujuktanda. Ferdinad De Sausure, mengemukakan pembagian tanda menjadi :

Penanda(Signifer)adalahtandayangdapatdilihatdaribentukfisik

Pertanda(Signifed)adalahmaknayangterungkapmelaluikonsepfungsiataunilai-nilaiyang terkandung.

RolanBarthes,membagitandamenjadiduayaitu:

Denotasi,yaitutingkatpertandayangmenjelaskanhubunganpenandadanpertandapadarealitas, menghasilkanmaknaeksplisit,langsung,danpasti.

Konotasi,yaitutingkatpertandamenjelaskanhubunganpenandadanpertandayangdidalamnya beroperasimaknayangtidakeksplisit,tidaklangsung,dantidakpasti.

Kelebihansemiotikdalam menelaahkaryasastra: Memperindahkaryasastra

Mengetahuikeindahankaryasastra

Dalam penelitiananalisisnyalebihspesifikdankomperhensif

Memberikan pemahaman makna dari simbolik baru dalam membaca karya sastra

Kita pembaca minimal mengetahui dua makna yaitu makna bahasa secara literlag dan maksna simbolik(global).

Referensi

Dokumen terkait

Memang benar walau tidak langsung mengobati penyebab langsung suatu penyakit, terapi pijat refleksi dapat membantu mengatasi berbagai masalah kesehatan, seperti sakit kepala,

 Ketika bahan melewati laras, ulir akan mengadoni bahan sehingga menjadi massa yang semi-padat dan plastis4.  Jika bahan dipanaskan &gt; 100 o C maka

Dengan bimbingan guru, siswa diminta untuk menemukan sifat-sifat dari bangun persegi ,persegi panjang ,segitiga4. Salah satu siswa maju ke depan kelas untuk menyebutkan

Mahkamah dalam putusan Nomor 92/PUU-X/2012, bertanggal 27 Maret 2013, telah memutus pasal 146 ayat (1) UU 27/2009, yang amarnya menyatakan, “pasal 146 ayat (1) bertentangan

Berdasarkan hasil observasi tersebut, maka peneliti juga menemukan hal yang sama di SMA Negeri 1 Sibabangun dari hasil wawancara, diketahui berdasarkan hasil data

Dalam penelitian dilakukan pemodelan jumlah kasus pneumonia balita dengan Geographically Weighted Poisson Regression (GWPR) dan mendeteksi kecamatan mana saja yang

Dari hasil pengujian yang telah dilakukan pada penelitian ini, diperoleh perbaikan rugi daya nyata paling optimal sebesar 94,92 % terhadap kondisi awal sistem

Jika kemudian hari ada claim dari pihak lain, bukan menjadi tanggung jawab Dosen Pembimbing dan pihak Fakultas Psikologi Universitas Islam Negeri Maulana Malik